Close

Magic™ Membrane Protein Human FXYD5 (FXYD domain containing ion transport regulator 5) Full Length (CAT#: MPC0506K) Made to Order

This product is a 19.4 kDa Human FXYD5 membrane protein expressed in E.coli. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • FXYD5
  • Protein Length
  • Full length
  • Protein Class
  • Transporter
  • Molecular Weight
  • 19.4 kDa
  • TMD
  • 1
  • Sequence
  • MSPSGRLCLLTIVGLILPTRGQTLKDTTSSSSADSTIMDIQVPTRAPDAV
    YTELQPTSPTPTWPADETPQPQTQTQQLEGTDGPLVTDPETHKSTKAAHP
    TDDTTTLSERPSPSTDVQTDPQTLKPSGFHEDDPFFYDEHTLRKRGLLVA
    AVLFITGIIILTSGKCRQLSRLCRNRCR

Product Description

  • Expression Systems
  • E.coli
  • Tag
  • Flag-StrepII or based on specific requirements
  • Protein Format
  • Detergent or based on specific requirements

Target

  • Target Protein
  • FXYD5
  • Full Name
  • FXYD domain containing ion transport regulator 5
  • Introduction
  • This gene encodes a member of a family of small membrane proteins that share a 35-amino acid signature sequence domain, beginning with the sequence PFXYD and containing 7 invariant and 6 highly conserved amino acids. The approved human gene nomenclature for the family is FXYD-domain containing ion transport regulator. Mouse FXYD5 has been termed RIC (Related to Ion Channel). FXYD2, also known as the gamma subunit of the Na,K-ATPase, regulates the properties of that enzyme. FXYD1 (phospholemman), FXYD2 (gamma), FXYD3 (MAT-8), FXYD4 (CHIF), and FXYD5 (RIC) have been shown to induce channel activity in experimental expression systems. Transmembrane topology has been established for two family members (FXYD1 and FXYD2), with the N-terminus extracellular and the C-terminus on the cytoplasmic side of the membrane. This gene product, FXYD5, is a glycoprotein that functions in the up-regulation of chemokine production, and it is involved in the reduction of cell adhesion via its ability to down-regulate E-cadherin. It also promotes metastasis, and has been linked to a variety of cancers. Alternative splicing results in multiple transcript variants.
  • Alternative Names
  • RIC; IWU1; KCT1; OIT2; DYSAD; HSPC113; PRO6241; FXYD domain-containing ion transport regulator 5; dysadherin; keratinocytes associated transmembrane protein 1; FXYD5; FXYD domain containing ion transport regulator 5

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2024 Creative Biolabs. | Contact Us