Close

Magic™ Membrane Protein Human GRIN1 (Glutamate ionotropic receptor NMDA type subunit 1) Expressed in E.coli with 6xHis tag at the N-terminus for Antibody Discovery, Partial (834-938aa) (CAT#: MPX4096K)

This product is a 18.0 kDa Human GRIN1 membrane protein expressed in E.coli. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • GRIN1
  • Protein Length
  • Partial (834-938aa)
  • Protein Class
  • Transporter; Ion channel
  • Molecular Weight
  • 18.0 kDa
  • TMD
  • 3
  • Sequence
  • EIAYKRHKDARRKQMQLAFAAVNVWRKNLQDRKSGRAEPDPKKKATFRAITSTLASSFKRRRSSKDTSTGGGRGALQNQKDTVLPRRAIEREEGQLQLCSRHRES

Product Description

  • Expression Systems
  • E.coli
  • Tag
  • 6xHis tag at the N-terminus
  • Protein Format
  • Soluble
  • Purity
  • >85% as determined by SDS-PAGE
  • Buffer
  • Tris-based buffer, 50% glycerol

Target

  • Target Protein
  • GRIN1
  • Full Name
  • Glutamate ionotropic receptor NMDA type subunit 1
  • Introduction
  • The protein encoded by this gene is a critical subunit of N-methyl-D-aspartate receptors, members of the glutamate receptor channel superfamily which are heteromeric protein complexes with multiple subunits arranged to form a ligand-gated ion channel. These subunits play a key role in the plasticity of synapses, which is believed to underlie memory and learning. Cell-specific factors are thought to control expression of different isoforms, possibly contributing to the functional diversity of the subunits. Alternatively spliced transcript variants have been described.
  • Alternative Names
  • NR1; MRD8; GluN1; NMDA1; NDHMSD; NDHMSR; NMD-R1; NMDAR1; glutamate receptor ionotropic, NMDA 1; N-methyl-D-aspartate receptor channel, subunit zeta-1; N-methyl-D-aspartate receptor subunit NR1; glutamate [NMDA] receptor subunit zeta-1; glutamate receptor, ionotropic, N-methyl D-aspartate 1; GRIN1; Glutamate ionotropic receptor NMDA type subunit 1

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2024 Creative Biolabs. | Contact Us