Close
Close

Magic™ Membrane Protein Human IL15RA (Interleukin 15 receptor subunit alpha) Expressed in Baculovirus/Insect expression system for Antibody Discovery, Partial (31-172aa) (CAT#: MPX0639K)

Datasheet
This product is a 42.6 kDa Human IL15RA membrane protein expressed in Baculovirus/Insect expression system. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • IL15RA
  • Protein Length
  • Partial (31-172aa)
  • Protein Class
  • Receptor
  • Molecular Weight
  • 42.6 kDa
  • TMD
  • 1
  • Sequence
  • ITCPPPMSVEHADIWVKSYSLYSRERYICN
    SGFKRKAGTSSLTECVLNKATNVAHWTTPSLKCIKPAASSPSSNNTAATTAAIVPGSQLMPSKSPSTGTTEISSHESSHGTPSQTTAKNWELTASASHQPPGVYPQGHSDTT

Product Description

  • Activity
  • Yes
  • Expression Systems
  • Baculovirus/Insect expression system
  • Tag
  • hIgG1 Fc and 6xHis tag at the C-terminus
  • Protein Format
  • Soluble
  • Reconstitution
  • Reconstitute at 100 μg/mL in sterile PBS.
  • Endotoxin
  • <0.10 EU per 1 μg of the protein by the LAL method.
  • Purity
  • >95%, by SDS-PAGE visualized with Silver Staining and quantitative densitometry by Coomassie® Blue Staining.
  • Buffer
  • Lyophilized from a 0.2 μm filtered solution in PBS.

Target

  • Target Protein
  • IL15RA
  • Full Name
  • Interleukin 15 receptor subunit alpha
  • Introduction
  • This gene encodes a cytokine receptor that specifically binds interleukin 15 (IL15) with high affinity. The receptors of IL15 and IL2 share two subunits, IL2R beta and IL2R gamma. This forms the basis of many overlapping biological activities of IL15 and IL2. The protein encoded by this gene is structurally related to IL2R alpha, an additional IL2-specific alpha subunit necessary for high affinity IL2 binding. Unlike IL2RA, IL15RA is capable of binding IL15 with high affinity independent of other subunits, which suggests distinct roles between IL15 and IL2. This receptor is reported to enhance cell proliferation and expression of apoptosis inhibitor BCL2L1/BCL2-XL and BCL2. Multiple alternatively spliced transcript variants of this gene have been reported.
  • Alternative Names
  • IL15RA; CD215; interleukin-15 receptor subunit alpha; interleukin 15 receptor, alpha; Interleukin 15 receptor subunit alpha

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2024 Creative Biolabs. | Contact Us