Close

Magic™ Membrane Protein Human IL2RG (Interleukin 2 receptor subunit gamma) Expressed in Baculovirus/Insect expression system with 6xHis tag at the C-terminus for Antibody Discovery, Partial (56-254aa, N75Q) (CAT#: MPX4212K)

This product is a 25.0 kDa Human IL2RG membrane protein expressed in Baculovirus/Insect expression system. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • IL2RG
  • Protein Length
  • Partial (56-254aa, N75Q)
  • Protein Class
  • Receptor
  • Molecular Weight
  • 25.0 kDa
  • TMD
  • 1
  • Sequence
  • PLPEVQCFVFNVEYMNCTWQSSSEPQPTNLTLHYWYKNSDNDKVQKCSHYLFSEEITSGCQLQKKEIHLYQTFVVQLQDPREPRRQATQMLKLQNLVIPWAPENLTLHKLSESQLELNWNNRFLNHCLEHLVQYRTDWDHSWTEQSVDYRHKFSLPSVDGQKRYTFRVRSRFNPLCGSAQHWSEWSHPIHWGSNTSKEN

Product Description

  • Expression Systems
  • Baculovirus/Insect expression system
  • Tag
  • 6xHis tag at the C-terminus
  • Protein Format
  • Soluble
  • Purity
  • >85% as determined by SDS-PAGE.
  • Buffer
  • Tris/PBS-based buffer, 6% Trehalose, pH 8.0

Target

  • Target Protein
  • IL2RG
  • Full Name
  • Interleukin 2 receptor subunit gamma
  • Introduction
  • The protein encoded by this gene is an important signaling component of many interleukin receptors, including those of interleukin -2, -4, -7 and -21, and is thus referred to as the common gamma chain. Mutations in this gene cause X-linked severe combined immunodeficiency (XSCID), as well as X-linked combined immunodeficiency (XCID), a less severe immunodeficiency disorder.
  • Alternative Names
  • IL2RG; P64; CIDX; IMD4; CD132; SCIDX; IL-2RG; SCIDX1; cytokine receptor common subunit gamma; CD132 antigen; IL-2 receptor subunit gamma; IL-2R subunit gamma; common cytokine receptor gamma chain; gammaC; interleukin 2 receptor, gamma; nonfunctional common cytokine receptor gamma chain; Interleukin 2 receptor subunit gamma

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2024 Creative Biolabs. | Contact Us