Close

Magic™ Membrane Protein Human IL4R (Interleukin 4 receptor) for Antibody Discovery (CAT#: MP0564X)

This product is a 25.6 kDa Human IL4R membrane protein expressed in in vitro wheat germ expression system with proprietary liposome technology. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • IL4R
  • Protein Length
  • Full-length
  • Molecular Weight
  • 25.6 kDa
  • TMD
  • 1
  • Sequence
  • MGWLCSGLLFPVSCLVLLQVASSGNMKVLQEPTCVSDYMSISTCEWKMNGPTNCSTELRLLYQLVFLLSEAHTCIPENNGGAGCVCHLLMDDVVSADNYTLDLWAGQQLLWKGSFKPSEHVKPRAPGNLTVHTNVSDTLLLTWSNPYPPDNYLYNHLTYAVNIWSENDPADFRIYNVTYLEPSLRIAASTLKSGISYRARVRAWAQCYNTTWSEWSPSTKWHNSNIC

Product Description

  • Application
  • Antibody Production
  • Expression Systems
  • in vitro wheat germ expression system with proprietary liposome technology
  • Tag
  • NO
  • Purification
  • None
  • Buffer
  • 25 mM Tris-HCl of pH8.0 containing 2% glycerol

Target

  • Target Protein
  • IL4R
  • Full Name
  • Interleukin 4 receptor
  • Introduction
  • This gene encodes the alpha chain of the interleukin-4 receptor, a type I transmembrane protein that can bind interleukin 4 and interleukin 13 to regulate IgE production. The encoded protein also can bind interleukin 4 to promote differentiation of Th2 cells. A soluble form of the encoded protein can be produced by proteolysis of the membrane-bound protein, and this soluble form can inhibit IL4-mediated cell proliferation and IL5 upregulation by T-cells. Allelic variations in this gene have been associated with atopy, a condition that can manifest itself as allergic rhinitis, sinusitus, asthma, or eczema. Polymorphisms in this gene are also associated with resistance to human immunodeficiency virus type-1 infection. Alternate splicing results in multiple transcript variants
  • Alternative Names
  • CD124; IL4RA; IL-4RA

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2024 Creative Biolabs. | Contact Us