Close
Close

Magic™ Membrane Protein Human KCNA1 (Potassium voltage-gated channel subfamily A member 1) expressed in E.coli for Antibody Discovery (CAT#: MP1374J)

Datasheet
This product is a 22.2 kDa Human KCNA1 membrane protein expressed in E.coli. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • KCNA1
  • Protein Length
  • Partial (1-154aa)
  • Protein Class
  • Ion Channel
  • Molecular Weight
  • 22.2 kDa
  • Sequence
  • MTVMSGENVDEASAAPGHPQDGSYPRQADHDDHECCERVVINISGLRFETQLKTLAQFPNTLLGNPKKRMRYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVPLDMFSEEIKFYELGEEAMEKFREDEGFIKEEERPLPEKEYQRQVW

Product Description

  • Expression Systems
  • E.coli
  • Tag
  • N-6xHis
  • Reconstitution
  • Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration).
  • Purity
  • >90% as determined by SDS-PAGE
  • Buffer
  • Liquid: Tris/PBS-based buffer, 5%-50% glycerol
    Lyophilized powder: Tris/PBS-based buffer, 6% Trehalose, pH 8.0

Target

  • Target Protein
  • KCNA1
  • Full Name
  • Potassium voltage-gated channel subfamily A member 1
  • Introduction
  • This gene encodes a voltage-gated delayed potassium channel that is phylogenetically related to the Drosophila Shaker channel. The encoded protein has six putative transmembrane segments (S1-S6), and the loop between S5 and S6 forms the pore and contains the conserved selectivity filter motif (GYGD). The functional channel is a homotetramer. The N-terminus of the channel is associated with beta subunits that can modify the inactivation properties of the channel as well as affect expression levels. The C-terminus of the channel is complexed to a PDZ domain protein that is responsible for channel targeting. Mutations in this gene have been associated with myokymia with periodic ataxia (AEMK).
  • Alternative Names
  • AEMK; EA1; Episodic ataxia with myokymia; HBK1; HUK1; Kca1 1; Kcna1; KCNA1_HUMAN; Kcpvd; KV1.1; MBK1; mceph; MGC124402; MGC126782; MGC138385; MK1; MK1, mouse, homolog of KV1.1; Potassium channel protein 1; Potassium voltage gated channel shaker related subfamily member 1; Potassium voltage gated channel subfamily A member 1; Potassium voltage gated channel, shaker related subfamily, member 1 (episodic ataxia with myokymia); Potassium voltage-gated channel subfamily A member 1; RBK1; RCK1; Shak; Shaker related subfamily member 1; Voltage gated potassium channel subunit Kv1.1; Voltage-gated K(+) channel HuKI; Voltage-gated potassium channel HBK1; Voltage-gated potassium channel subunit Kv1.1

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2024 Creative Biolabs. | Contact Us