Close

Magic™ Membrane Protein Human NDUFA13 (NADH:ubiquinone oxidoreductase subunit A13) Full Length (CAT#: MPC4781K) Made to Order

This product is a made-to-order Human NDUFA13 membrane protein expressed in HEK293. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • NDUFA13
  • Protein Length
  • Full length
  • Protein Class
  • Transport
  • TMD
  • 1
  • Sequence
  • MAASKVKQDMPPPGGYGPIDYKRNLPRRGLSGYSMLAIGIGTLIYGHWSI
    MKWNRERRRLQIEDFEARIALLPLLQAETDRRTLQMLRENLEEEAIIMKD
    VPDWKVGESVFHTTRWVPPLIGELYGLRTTEEALHASHGFMWYT

Product Description

  • Expression Systems
  • HEK293
  • Tag
  • Flag-StrepII or based on specific requirements
  • Protein Format
  • Detergent or based on specific requirements (Detergent, Liposome, Nanodisc, SMALPs, VLP)

Target

  • Target Protein
  • NDUFA13
  • Full Name
  • NADH:ubiquinone oxidoreductase subunit A13
  • Introduction
  • This gene encodes a subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), which functions in the transfer of electrons from NADH to the respiratory chain. The protein is required for complex I assembly and electron transfer activity. The protein binds the signal transducers and activators of transcription 3 (STAT3) transcription factor, and can function as a tumor suppressor. The human protein purified from mitochondria migrates at approximately 16 kDa. Transcripts originating from an upstream promoter and capable of expressing a protein with a longer N-terminus have been found, but their biological validity has not been determined.
  • Alternative Names
  • NDUFA13; B16.6; CDA016; CGI-39; GRIM19; GRIM-19; MC1DN28; NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13; CI-B16.6; NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 13; NADH-ubiquinone oxidoreductase B16.6 subunit; cell death regulatory protein GRIM-19; cell death-regulatory protein GRIM19; complex I B16.6 subunit; complex I-B16.6; gene associated with retinoic and IFN-induced mortality 19 protei; gene associated with retinoic and interferon-induced mortality 19 protein; NADH:ubiquinone oxidoreductase subunit A13

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2024 Creative Biolabs. | Contact Us