Close

Magic™ Membrane Protein Human NDUFA4 (NDUFA4 mitochondrial complex associated) expressed by in vitro wheat germ expression system for Antibody Discovery (CAT#: MP0764X)

This product is a 35.8 kDa Human NDUFA4 membrane protein expressed in in vitro wheat germ expression system. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • NDUFA4
  • Protein Length
  • Full-length
  • Molecular Weight
  • 35.8 kDa
  • Sequence
  • MLRQIIGQAKKHPSLIPLFVFIGTGATGATLYLLRLALFNPDVCWDRNNPEPWNKLGPNDQYKFYSVNVDYSKLKKERPDF

Product Description

  • Application
  • Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein), Antibody Production, Protein Array
  • Expression Systems
  • in vitro wheat germ expression system
  • Tag
  • GST-tag at N-terminal
  • Purification
  • Glutathione Sepharose 4 Fast Flow
  • Buffer
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer

Target

  • Target Protein
  • NDUFA4
  • Full Name
  • NDUFA4 mitochondrial complex associated
  • Introduction
  • The protein encoded by this gene belongs to the complex I 9kDa subunit family. Mammalian complex I of mitochondrial respiratory chain is composed of 45 different subunits. This protein has NADH dehydrogenase activity and oxidoreductase activity. It transfers electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiqui.
  • Alternative Names
  • MLRQ; CI-9k; COXFA4; CI-MLRQ; MC4DN21; cytochrome c oxidase subunit NDUFA4; Complex I 9kDa subunit; NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 4, 9kDa; NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 4; NADH-ubiquinone oxidoreductase MLRQ subunit; complex I-MLRQ; cytochrome c oxidase subunit FA4; NADH-ubiquinone oxidoreductase MLRQ subunit

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2024 Creative Biolabs. | Contact Us