Close

Magic™ Membrane Protein Human NDUFA5 (NADH:ubiqui oxidoreductase subunit A5) for Antibody Discovery (CAT#: MP0765X)

This product is a 39.9 kDa Human NDUFA5 membrane protein expressed in in vitro wheat germ expression system. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • NDUFA5
  • Protein Length
  • Full-length
  • Molecular Weight
  • 39.9 kDa
  • Sequence
  • MAGVLKKTTGLVGLAVCNTPHERLRILYTKILDVLEEIPKNAAYRKYTEQITNEKLAMVKAEPDVKKLEDQLQGGQLEEVILQAEHELNLARKMREWKLWEPLVEEPPADQWKWPI

Product Description

  • Application
  • Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein), Antibody Production, Protein Array
  • Expression Systems
  • in vitro wheat germ expression system
  • Tag
  • GST-tag at N-terminal
  • Purification
  • Glutathione Sepharose 4 Fast Flow
  • Buffer
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer

Target

  • Target Protein
  • NDUFA5
  • Full Name
  • NADH:ubiqui oxidoreductase subunit A5
  • Introduction
  • This nuclear gene encodes a conserved protein that comprises the B13 subunit of complex I of the mitochondrial respiratory chain. The encoded protein localizes to the inner mitochondrial membrane, where it is thought to aid in the transfer of electrons from NADH to ubiqui. Alternative splicing results in multiple transcript variants. There are numerous pseudogenes of this gene on chromosomes 1, 3, 6, 8, 9, 11, 12, and 16.
  • Alternative Names
  • B13; NUFM; UQOR13; CI-13kB; CI-13KD-B; NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5; NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 5, 13kDa; NADH-ubiquinone oxidoreductase 13 kDa-B subunit; complex I 13kDa subunit B; complex I subunit B13; type I dehydrogenase; ubiquinone reductase; NADH-ubiquinone oxidoreductase 13 kDa-B subunit

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2024 Creative Biolabs. | Contact Us