Close

Magic™ Membrane Protein Human NDUFA8 (NADH:ubiqui oxidoreductase subunit A8) for Antibody Discovery (CAT#: MP0768X)

This product is a 46.5 kDa Human NDUFA8 membrane protein expressed in in vitro wheat germ expression system. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • NDUFA8
  • Protein Length
  • Full-length
  • Molecular Weight
  • 46.5 kDa
  • Sequence
  • MPGIVELPTLEELKVDEVKISSAVLKAAAHHYGAQCDKPNKEFMLCRWEEKDPRRCLEEGKLVNKCALDFFRQIKRHCAEPFTEYWTCIDYTGQQLFRHCRKQQAKFDECVLDKLGWVRPDLGELSKVTKVKTDRPLPENPYHSRPRPDPSPEIEGDLQPATHGSRFYFWTK

Product Description

  • Application
  • Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein), Antibody Production, Protein Array
  • Expression Systems
  • in vitro wheat germ expression system
  • Tag
  • GST-tag at N-terminal
  • Purification
  • Glutathione Sepharose 4 Fast Flow
  • Buffer
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer

Target

  • Target Protein
  • NDUFA8
  • Full Name
  • NADH:ubiqui oxidoreductase subunit A8
  • Introduction
  • The protein encoded by this gene belongs to the complex I 19 kDa subunit family. Mammalian complex I is composed of 45 different subunits. This protein has NADH dehydrogenase activity and oxidoreductase activity. It plays an important role in transfering electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiqui. Alternative splicing of this gene results in multiple transcript variants encoding different isoforms.
  • Alternative Names
  • PGIV; CI-19KD; CI-PGIV; NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8; NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 8, 19kDa; NADH-ubiquinone oxidoreductase 19 kDa subunit; NADH:ubiquinone oxidoreductase PGIV subunit; complex I-19kD; complex I-PGIV; Complex I-19kD; Complex I-PGIV; NADH-ubiquinone oxidoreductase 19 kDa subunit

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2024 Creative Biolabs. | Contact Us