Close

Magic™ Membrane Protein Human NDUFB2 (NADH:ubiqui oxidoreductase subunit B2) for Antibody Discovery (CAT#: MP0772X)

This product is a 38.5 kDa Human NDUFB2 membrane protein expressed in in vitro wheat germ expression system. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • NDUFB2
  • Protein Length
  • Full-length
  • Molecular Weight
  • 38.5 kDa
  • Sequence
  • MSALTRLASFARVGGRLFRSGCARTAGDGGVRHAGGGVHIEPRYRQFPQLTRSQVFQSEFFSGLMWFWILWRFWHDSEEVLGHFPYPDPSQWTDEELGIPPDDED

Product Description

  • Application
  • Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein), Antibody Production, Protein Array
  • Expression Systems
  • in vitro wheat germ expression system
  • Tag
  • GST-tag at N-terminal
  • Purification
  • Glutathione Sepharose 4 Fast Flow
  • Buffer
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer

Target

  • Target Protein
  • NDUFB2
  • Full Name
  • NADH:ubiqui oxidoreductase subunit B2
  • Introduction
  • The protein encoded by this gene is a subunit of the multisubunit NADH:ubiqui oxidoreductase (complex I). Mammalian complex I is composed of 45 different subunits. This protein has NADH dehydrogenase activity and oxidoreductase activity. It plays a important role in transfering electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiqui. Hydropathy analysis revealed that this subunit and 4 other subunits have an overall hydrophilic pattern, even though they are found within the hydrophobic protein (HP) fraction of complex I.
  • Alternative Names
  • AGGG; CI-AGGG; NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial; NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 2, 8kDa; NADH-ubiquinone oxidoreductase AGGG subunit; complex I AGGG subunit; complex I-AGGG; Complex I-AGGG; NADH-ubiquinone oxidoreductase AGGG subunit

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2024 Creative Biolabs. | Contact Us