Close

Magic™ Membrane Protein Human NDUFB3 (NADH:ubiqui oxidoreductase subunit B3) for Antibody Discovery (CAT#: MP0773X)

This product is a 36.3 kDa Human NDUFB3 membrane protein expressed in in vitro wheat germ expression system. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • NDUFB3
  • Protein Length
  • Full-length
  • Molecular Weight
  • 36.3 kDa
  • TMD
  • 1
  • Sequence
  • MAHEHGHEHGHHKMELPDYRQWKIEGTPLETIQKKLAAKGLRDPWGRNEAWRYMGGFAKSVSFSDVFFKGFKWGFAAFVVAVGAEYYLESLNKDKKHH

Product Description

  • Application
  • Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein), Antibody Production, Protein Array
  • Expression Systems
  • in vitro wheat germ expression system
  • Tag
  • GST-tag at N-terminal
  • Purification
  • Glutathione Sepharose 4 Fast Flow
  • Buffer
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer

Target

  • Target Protein
  • NDUFB3
  • Full Name
  • NADH:ubiqui oxidoreductase subunit B3
  • Introduction
  • This gene encodes an accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) which is the first enzyme in the electron transport chain of mitochondria. This protein localizes to the inner membrane of the mitochondrion as a single-pass membrane protein. Mutations in this gene contribute to mitochondrial complex 1 deficiency. Alternative splicing results in multiple transcript variants encoding the same protein. Humans have multiple pseudogenes of this gene.
  • Alternative Names
  • B12; CI-B12; MC1DN25; NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3; NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 3, 12kDa; NADH-ubiquinone oxidoreductase B12 subunit; complex I-B12; NADH-ubiquinone oxidoreductase B12 subunit

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2024 Creative Biolabs. | Contact Us