Close

Magic™ Membrane Protein Human NDUFB5 (NADH:ubiquinone oxidoreductase subunit B5) Expressed in E.coli with 6xHis and SUMO tag at the N-terminus for Antibody Discovery, Partial (94-189aa) (CAT#: MPX4652K)

This product is a 27.5kDa Human NDUFB5 membrane protein expressed in E.coli. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • NDUFB5
  • Protein Length
  • Partial (94-189aa)
  • Protein Class
  • Transporter
  • Molecular Weight
  • 27.5kDa
  • TMD
  • 1
  • Sequence
  • GQAELAEIPEGYVPEHWEYYKHPISRWIARNFYDSPEKIYERTMAVLQIEAEKAELRVKELEVRKLMHVRGDGPWYYYETIDKELIDHSPKATPDN

Product Description

  • Expression Systems
  • E.coli
  • Tag
  • 6xHis and SUMO tag at the N-terminus
  • Protein Format
  • Soluble
  • Purity
  • >90% as determined by SDS-PAGE
  • Buffer
  • Tris-based buffer, 50% glycerol

Target

  • Target Protein
  • NDUFB5
  • Full Name
  • NADH:ubiquinone oxidoreductase subunit B5
  • Introduction
  • The protein encoded by this gene is a subunit of the multisubunit NADH:ubiquinone oxidoreductase (complex I). Mammalian complex I is composed of 45 different subunits. It locates at the mitochondrial inner membrane. This protein has NADH dehydrogenase activity and oxidoreductase activity. It transfers electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone. Three transcript variants encoding different isoforms have been found for this gene.
  • Alternative Names
  • NDUFB5; SGDH; CISGDH; NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial; NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 5, 16kDa; NADH-ubiquinone oxidoreductase SGDH subunit; complex I SGDH subunit; complex I-SGDH; NADH:ubiquinone oxidoreductase subunit B5

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2024 Creative Biolabs. | Contact Us