Close

Magic™ Membrane Protein Human NDUFC2 (NADH:ubiqui oxidoreductase subunit C2) for Antibody Discovery (CAT#: MP0778X)

This product is a 40.6 kDa Human NDUFC2 membrane protein expressed in in vitro wheat germ expression system. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • NDUFC2
  • Protein Length
  • Full-length
  • Molecular Weight
  • 40.6 kDa
  • TMD
  • 1
  • Sequence
  • MIARRNPEPLRFLPDEARSLPPPKLTDPRLLYIGFLGYCSGLIDNLIRRRPIATAGLHRQLLYITAFFFAGYYLVKREDYLYAVRDREMFGYMKLHPEDFPEEDKKTYGEIFEKFHPIR

Product Description

  • Application
  • Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein), Antibody Production, Protein Array
  • Expression Systems
  • in vitro wheat germ expression system
  • Tag
  • GST-tag at N-terminal
  • Purification
  • Glutathione Sepharose 4 Fast Flow
  • Buffer
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer

Target

  • Target Protein
  • NDUFC2
  • Full Name
  • NADH:ubiqui oxidoreductase subunit C2
  • Introduction
  • Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiqui.
  • Alternative Names
  • HLC-1; B14.5b; NADHDH2; CI-B14.5b; NADH dehydrogenase [ubiquinone] 1 subunit C2; NADH dehydrogenase (ubiquinone) 1, subcomplex unknown, 2, 14.5kDa; NADH-ubiquinone oxidoreductase subunit B14.5b; complex I subunit B14.5b; complex I-B14.5b; human lung cancer oncogene 1 protein; Human lung cancer oncogene 1 protein; NADH-ubiquinone oxidoreductase subunit B14.5b; NADH-ubiquinone oxidoreductase subunit B14.5b

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2024 Creative Biolabs. | Contact Us