Close
Close

Magic™ Membrane Protein Human NDUFV3 (NADH:ubiqui oxidoreductase subunit V3) for Antibody Discovery (CAT#: MP0788X)

Datasheet
This product is a 38.3 kDa Human NDUFV3 membrane protein expressed in in vitro wheat germ expression system. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • NDUFV3
  • Protein Length
  • Full-length
  • Molecular Weight
  • 38.3 kDa
  • Sequence
  • MAAPCLLRQGRAGALKTMLQEAQVFRGLASTVSLSAESGKSEKGQPQNSKKQSPPKKPAPVPAEPFDNTTYKNLQHHDYSTYTFLDLNLELSKFRMPQPSSGRESPRH

Product Description

  • Application
  • Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein), Antibody Production, Protein Array
  • Expression Systems
  • in vitro wheat germ expression system
  • Tag
  • GST-tag at N-terminal
  • Purification
  • Glutathione Sepharose 4 Fast Flow
  • Buffer
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer

Target

  • Target Protein
  • NDUFV3
  • Full Name
  • NADH:ubiqui oxidoreductase subunit V3
  • Introduction
  • The protein encoded by this gene is one of at least forty-one subunits that make up the NADH-ubiqui oxidoreductase complex. This complex is part of the mitochondrial respiratory chain and serves to catalyze the rote -sensitive oxidation of NADH and the reduction of ubiqui. The encoded protein is one of three proteins found in the flavoprotein fraction of the complex. The specific function of the encoded protein is unknown. Two transcript variants encoding different isoforms have been found for this gene.
  • Alternative Names
  • CI-10k; CI-9KD; NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial; NADH dehydrogenase (ubiquinone) flavoprotein 3, 10kDa; NADH-ubiquinone oxidoreductase 9 kD subunit; NADH-ubiquinone oxidoreductase 9 kDa subunit; NADH-ubiquinone oxidoreductase flavoprotein 3, 10kD; complex I 10kDa subunit; complex I, mitochondrial respiratory chain, 10-kD subunit; complex I-9kD; mitochondrial NADH oxidoreductase-like protein; renal carcinoma antigen NY-REN-4; Complex I-9kD; Renal carcinoma antigen NY-REN-4

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2024 Creative Biolabs. | Contact Us