Close
Close

Magic™ Membrane Protein Human SLC27A2 (Solute carrier family 27 member 2) Expressed in E.coli with 6xHis and SUMO tag at the N-terminus for Antibody Discovery, Partial (283-620aa) (CAT#: MPX4528K)

Datasheet
This product is a 54.8kDa Human SLC27A2 membrane protein expressed in E.coli. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • SLC27A2
  • Protein Length
  • Partial (283-620aa)
  • Protein Class
  • Transporter
  • Molecular Weight
  • 54.8kDa
  • TMD
  • 3
  • Sequence
  • GATLALRTKFSASQFWDDCRKYNVTVIQYIGELLRYLCNSPQKPNDRDHKVRLALGNGLRGDVWRQFVKRFGDICIYEFYAATEGNIGFMNYARKVGAVGRVNYLQKKIITYDLIKYDVEKDEPVRDENGYCVRVPKGEVGLLVCKITQLTPFNGYAGAKAQTEKKKLRDVFKKGDLYFNSGDLLMVDHENFIYFHDRVGDTFRWKGENVATTEVADTVGLVDFVQEVNVYGVHVPDHEGRIGMASIKMKENHEFDGKKLFQHIADYLPSYARPRFLRIQDTIEITGTFKHRKMTLVEEGFNPAVIKDALYFLDDTAKMYVPMTEDIYNAISAKTLKL

Product Description

  • Expression Systems
  • E.coli
  • Tag
  • 6xHis and SUMO tag at the N-terminus
  • Protein Format
  • Soluble
  • Purity
  • >90% as determined by SDS-PAGE
  • Buffer
  • Tris-based buffer, 50% glycerol

Target

  • Target Protein
  • SLC27A2
  • Full Name
  • Solute carrier family 27 member 2
  • Introduction
  • The protein encoded by this gene is an isozyme of long-chain fatty-acid-coenzyme A ligase family. Although differing in substrate specificity, subcellular localization, and tissue distribution, all isozymes of this family convert free long-chain fatty acids into fatty acyl-CoA esters, and thereby play a key role in lipid biosynthesis and fatty acid degradation. This isozyme activates long-chain, branched-chain and very-long-chain fatty acids containing 22 or more carbons to their CoA derivatives. It is expressed primarily in liver and kidney, and is present in both endoplasmic reticulum and peroxisomes, but not in mitochondria. Its decreased peroxisomal enzyme activity is in part responsible for the biochemical pathology in X-linked adrenoleukodystrophy. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
  • Alternative Names
  • VLCS; FATP2; VLACS; ACSVL1; FACVL1; hFACVL1; HsT17226; very long-chain acyl-CoA synthetase; FATP-2; THCA-CoA ligase; arachidonate--CoA ligase; fatty acid transport protein 2; fatty-acid-coenzyme A ligase, very long-chain 1; long-chain-fatty-acid--CoA ligase; phytanate--CoA ligase; solute carrier family 27 (fatty acid transporter), member 2; very long-chain fatty-acid-coenzyme A ligase 1; very long-chain-fatty-acid-CoA ligase; SLC27A2; Solute carrier family 27 member 2

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2024 Creative Biolabs. | Contact Us