Close

Magic™ Membrane Protein Human SLC39A5 (Solute carrier family 39 member 5) expressed in In vitro wheat germ expression system for Antibody Discovery (CAT#: MP1236X)

This product is a 82.83 kDa Human SLC39A5 membrane protein expressed in In vitro wheat germ expression system with proprietary liposome technology. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • SLC39A5
  • Protein Length
  • Full-length
  • Molecular Weight
  • 82.83 kDa
  • TMD
  • 6
  • Sequence
  • VGGSVPNLGPAEQEQNHYLAQLFGLYGENGTLTAGGLARLLHSLGLGRVQGLRLGQHGPLTGRAASPAADNSTHRPQNPELSVDVWAGMPLGPSGWGDLEESKAPHLPRGPAPSGLDLLHRLLLLDHSLADHLNEDCLNGSQLLVNFGLSPAAPLTPRQFALLCPALLYQIDSRVCIGAPAPAPPGDLLSALLQSALAVLLLSLPSPLSLLLLRLLGPRLLRPLLGFLGALAVGTLCGDALLHLLPHAQEGRHAGPGGLPEKDLGPGLSVLGGLFLLFVLENMLGLLRHRGLRPRCCRRKRRNLETRNLDPENGSGMALQPLQAAPEPGAQGQREKNSQHPPALAPPGHQGHSHGHQGGTDITWMVLLGDGLHNLTDGLAIGAAFSDGFSSGLSTTLAVFCHELPHELGDFAMLLQSGLSFRRLLLLSLVSGALGLGGAVLGVGLSLGPVPLTPWVFGVTAGVFLYVALVDMLPALLRPPEPLPTPHVLLQGLGLLLGGGLMLAITLLEERLLPVTTEG

Product Description

  • Application
  • Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein), Antibody Production, Protein Array
  • Expression Systems
  • In vitro wheat germ expression system with proprietary liposome technology
  • Tag
  • GST-tag at N-terminal
  • Purification
  • Glutathione Sepharose 4 Fast Flow
  • Buffer
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0

Target

  • Target Protein
  • SLC39A5
  • Full Name
  • Solute carrier family 39 member 5
  • Introduction
  • The protein encoded by this gene belongs to the ZIP family of zinc transporters that transport zinc into cells from outside, and play a crucial role in controlling intracellular zinc levels. Zinc is an essential cofactor for many enzymes and proteins involved in gene transcription, growth, development and differentiation. Mutations in this gene have been associated with autosomal dominant high myopia (MYP24). Alternatively spliced transcript variants have been found for this gene.
  • Alternative Names
  • ZIP5; MYP24; LZT-Hs7; zinc transporter ZIP5; solute carrier family 39 (metal ion transporter), member 5; solute carrier family 39 (zinc transporter), member 5; zrt- and Irt-like protein 5

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2024 Creative Biolabs. | Contact Us