Close

Magic™ Membrane Protein Human TMX2 (Thioredoxin related transmembrane protein 2) Expressed in E.coli for Antibody Discovery, Partial (125-296aa) (CAT#: MPX0139K)

This product is a 22 kDa Human TMX2 membrane protein expressed in E.coli. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • TMX2
  • Protein Length
  • Partial (125-296aa)
  • Protein Class
  • Transporter
  • Molecular Weight
  • 22 kDa
  • TMD
  • 1
  • Sequence
  • MGSSHHHHHHSSGLVPRGSHMTCKPPLYMGPEYIKYFNDKTIDEELERDKRVTWIVEFFANWSNDCQSFAPIYADLSLKYNCTGLNFGKVDVGRYTDVSTRYKVSTSPLTKQLPTLILFQGGKEAMRRPQIDKKGRAVSWTFSEENVIREFNLNELYQRAKKLSKAGDNIPEEQPVASTPTTVSDGENKKDK

Product Description

  • Expression Systems
  • E.coli
  • Tag
  • His tag at the N-terminus
  • Protein Format
  • Soluble
  • Endotoxin
  • < 1.0 EU per 1 μg
  • Purity
  • > 95 % SDS-PAGE determined by SEC-HPLC and reducing SDS-PAGE.
  • Buffer
  • pH: 8.00, Constituents: 0.24% Tris, 0.87% Sodium chloride

Target

  • Target Protein
  • TMX2
  • Full Name
  • Thioredoxin related transmembrane protein 2
  • Introduction
  • This gene encodes a member of the disulfide isomerase (PDI) family of endoplasmic reticulum (ER) proteins that catalyze protein folding and thiol-disulfide interchange reactions. The encoded protein has an N-terminal ER-signal sequence, a catalytically active thioredoxin domain, one transmembrane domain and a C-terminal ER-retention sequence. This protein is enriched on the mitochondria-associated-membrane of the ER via palmitoylation of two of its cytosolically exposed cysteines.
  • Alternative Names
  • TMX2; PIG26; CGI-31; PDIA12; NEDMCMS; TXNDC14; thioredoxin-related transmembrane protein 2; cell proliferation-inducing gene 26 protein; growth-inhibiting gene 11; protein disulfide isomerase family A, member 12; thioredoxin domain-containing protein 14; Thioredoxin related transmembrane protein 2

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2024 Creative Biolabs. | Contact Us