Close

Magic™ Membrane Protein Human TNFRSF11A (TNF receptor superfamily member 11a) Expressed in E.coli with 6xHis tag at the N-terminus for Antibody Discovery, Partial (28-202aa) (CAT#: MPX4222K)

This product is a 23.2kDa Human TNFRSF11A membrane protein expressed in E.coli. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • TNFRSF11A
  • Protein Length
  • Partial (28-202aa)
  • Protein Class
  • Receptor
  • Molecular Weight
  • 23.2kDa
  • TMD
  • 1
  • Sequence
  • LQIAPPCTSEKHYEHLGRCCNKCEPGKYMSSKCTTTSDSVCLPCGPDEYLDSWNEEDKCLLHKVCDTGKALVAVVAGNSTTPRRCACTAGYHWSQDCECCRRNTECAPGLGAQHPLQLNKDTVCKPCLAGYFSDAFSSTDKCRPWTNCTFLGKRVEHHGTEKSDAVCSSSLPARK

Product Description

  • Expression Systems
  • E.coli
  • Tag
  • 6xHis tag at the N-terminus
  • Protein Format
  • Soluble
  • Purity
  • >90% as determined by SDS-PAGE
  • Buffer
  • Tris/PBS-based buffer, 6% Trehalose, pH 8.0

Target

  • Target Protein
  • TNFRSF11A
  • Full Name
  • TNF receptor superfamily member 11a
  • Introduction
  • The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptors can interact with various TRAF family proteins, through which this receptor induces the activation of NF-kappa B and MAPK8/JNK. This receptor and its ligand are important regulators of the interaction between T cells and dendritic cells. This receptor is also an essential mediator for osteoclast and lymph node development. Mutations at this locus have been associated with familial expansile osteolysis, autosomal recessive osteopetrosis, and Paget disease of bone. Alternatively spliced transcript variants have been described for this locus.
  • Alternative Names
  • TNFRSF11A; FEO; OFE; ODFR; OSTS; PDB2; RANK; CD265; OPTB7; TRANCER; LOH18CR1; TRANCE-R; tumor necrosis factor receptor superfamily member 11A; Paget disease of bone 2; TRANCE recepto;
    familial expansile osteolysis; loss of heterozygosity, 18, chromosomal region 1; osteoclast differentiation factor receptor; receptor activator of NF-KB; receptor activator of nuclear factor-kappa B; tumor necrosis factor receptor superfamily, member 11a, NFKB activator; TNF receptor superfamily member 11a

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2024 Creative Biolabs. | Contact Us