ABCE1, also known as ABC38, OABP, RNASEL1, RNASELI, ribonuclease L (2,5-Oligoisoadenylate synthetase-dependent) inhibitor, or ATP-binding cassette, sub-family E (OABP), member 1, is a 67.3 kDa transport protein that is composed by 599 amino acids. In humans, it is encoded by the ABCE3 gene located at the chromosome 4q31.21. ABCE1 as an ATPase belongs to a superfamily of ATP-binding cassette (ABC) transporters and an OABP subfamily. So far, there are 49 human transporters of ABC families have been identified, performing various functions in cells and mediating the transport of specific substrates across biological membranes, including sugar, lipids, and chloride. The protein sequences of ABCE1 between species are very well conserved, for instance, Pixie and yeast Rli1p shares 66% identity, and Rli1p and human ABCR1 have 67% identity.
Basic Information of ABCE1 | |
Protein Name | ATP-binding cassette sub-family E member 1 |
Gene Name | ABCE1 |
Aliases | 2'-5'-oligoadenylate-binding protein, HuHP68, RNase L inhibitor, Ribonuclease 4 inhibitor, RNS4I |
Organism | Homo sapiens (Human) |
UniProt ID | P61221 |
Transmembrane Times | |
Length (aa) | 599 |
Sequence | MADKLTRIAIVNHDKCKPKKCRQECKKSCPVVRMGKLCIEVTPQSKIAWISETLCIGCGICIKKCPFGALSIVNLPSNLEKETTHRYCANAFKLHRLPIPRPGEVLGLVGTNGIGKSTALKILAGKQKPNLGKYDDPPDWQEILTYFRGSELQNYFTKILEDDLKAIIKPQYVDQIPKAAKGTVGSILDRKDETKTQAIVCQQLDLTHLKERNVEDLSGGELQRFACAVVCIQKADIFMFDEPSSYLDVKQRLKAAITIRSLINPDRYIIVVEHDLSVLDYLSDFICCLYGVPSAYGVVTMPFSVREGINIFLDGYVPTENLRFRDASLVFKVAETANEEEVKKMCMYKYPGMKKKMGEFELAIVAGEFTDSEIMVMLGENGTGKTTFIRMLAGRLKPDEGGEVPVLNVSYKPQKISPKSTGSVRQLLHEKIRDAYTHPQFVTDVMKPLQIENIIDQEVQTLSGGELQRVALALCLGKPADVYLIDEPSAYLDSEQRLMAARVVKRFILHAKKTAFVVEHDFIMATYLADRVIVFDGVPSKNTVANSPQTLLAGMNKFLSQLEITFRRDPNNYRPRINKLNSIKDVEQKKSGNYFFLDD |
ABCE1 has a cysteine-rich N-terminal region that is supposed to tightly bind two [4Fe-4S] clusters. Depletion of available Fe/S clusters or mutation of this region renders the protein unable to function and loss of cell viability, which confers ABCE1 the only known important cytoplasmic protein dependent on the Fe/S cluster biosynthesis in mitochondria. The ABCE1 protein was initially described as a ribonuclease L inhibitor (RNase L Inhibitor). Recent evidence has identified ABCE1 as a ribosome-recycling factor essential for the translation initiation, elongation, termination, as well as ribosome recycling in eukaryotes. As a negative regulator of the 2-5A (5'-phosphorylated 2', 5'-linked oligoadenylates)/RNase L system, ABCE1 is able to regulate the RNA stability of cell and may be implicated in a wide range of biological functions, such as viral infection and tumor cell proliferation. Later, this protein is manifested as a host factor critical for the assembly of primate lentivirus capsids, especially for human immunodeficiency virus-1 (HIV-1).
Fig.1 Interactions of ABCE1 with the small 40S ribosomal subunit. (Heuer, 2017)
This study showed that ribosome-correlated co-translational quality control forms an early signal to trigger mitophagy. The final results have demonstrated extensive therapeutic implications for further understanding and treatments of neurodegenerative diseases.
Based on an analysis of published late-stage 48S initiation complex from rabbit, this paper provided new mechanistic views about this putative role of ABCE1 in initiation. This point of opinion represented the first structural evidence in which the regulatory function of this recycling factor ABCE1 in initiation is discussed.
ABCE1, an important ATP-binding cassette (ABC) protein, splits 80S ribosomes into 60S and 40S subunits after classical termination or quality-control-based mRNA surveillance events. Nevertheless, the underlying splitting mechanism is still enigmatic. Thus, this review presented a cryo-EM structure of yeast 40S-ABCE1 post-splitting complex at 3.9-Å resolution.
Retinoblastoma is known as a rare malignancy in developing retina tissue of children with limited therapeutic choices. This paper tried to investigate underlying clinical values of genistein, that is a phytoestrogen derived from soybeans with antioxidant activity.
The results in this study demonstrated an indispensable role of Fe-S clusters when ABCE1 involves in the proliferation and the migration of LUADs through interacting with β-actin. The Fe-S cluster of ABCE1 may be a potential target for the prevention of lung adenocarcinoma metastasis.
To produce a soluble and intact membrane protein as demands, we present mature reconstitution forms and active formats for the proteins using our mature work lines. Our strong Magic™ membrane protein production platform is able to enable a number of flexible options, from which customers can always find the most suitable one to achieve their purposes. Aided by our versatile Magic™ anti-membrane protein antibody discovery platform, we also provide customized anti-ABCE1 antibody development services.
Creative Biolabs as an expert in the field of protein markets has gained high praise from global users for successfully completed projects. Here, we would like to provide varieties of professional biotechnologies in required formats, especially membrane protein preparation services. Please feel free to contact us for more quotes.
Reference
All listed services and products are For Research Use Only. Do Not use in any diagnostic or therapeutic applications.