ABHD2, the abbreviation of Abhydrolase domain-containing protein 2, is encoded by the ABHD2 gene. It is a serine hydrolase enzyme that is strongly expressed in human spermatozoa. It is a key controller of sperm hyperactivation, which is a critical step in allowing sperm to fertilize an egg. This protein contains an alpha/beta hydrolase fold, which is a catalytic domain found in different kinds of enzymes. This gene can be spliced into two transcript variants which encode the same proteins. It’s related to emphysema, and atherosclerotic lesions.
Basic Information of ABHD2 | |
Protein Name | Monoacylglycerol lipase ABHD2 |
Gene Name | ABHD2 |
Aliases | 2-arachidonoylglycerol hydrolase, Abhydrolase domain-containing protein 2, Lung alpha/beta hydrolase 2, Protein PHPS1-2, LABH2 |
Organism | Homo sapiens (Human) |
UniProt ID | P08910 |
Transmembrane Times | 1 |
Length (aa) | 425 |
Sequence | MNAMLETPELPAVFDGVKLAAVAAVLYVIVRCLNLKSPTAPPDLYFQDSGLSRFLLKSCPLLTKEYIPPLIWGKSGHIQTALYGKMGRVRSPHPYGHRKFITMSDGATSTFDLFEPLAEHCVGDDITMVICPGIANHSEKQYIRTFVDYAQKNGYRCAVLNHLGALPNIELTSPRMFTYGCTWEFGAMVNYIKKTYPLTQLVVVGFSLGGNIVCKYLGETQANQEKVLCCVSVCQGYSALRAQETFMQWDQCRRFYNFLMADNMKKIILSHRQALFGDHVKKPQSLEDTDLSRLYTATSLMQIDDNVMRKFHGYNSLKEYYEEESCMRYLHRIYVPLMLVNAADDPLVHESLLTIPKSLSEKRENVMFVLPLHGGHLGFFEGSVLFPEPLTWMDKLVVEYANAICQWERNKLQCSDTEQVEADLE |
ABHD2, the full name is abhydrolase domain-containing protein 2. It’s able to cleave 2-arachidonoylglycerol (2AG) into glycerol and arachidonic acid (AA), in the presence of progesterone or pregnenolone sulfate. 2AG can suppress sperm calcium channel-CatSper. When ABHD2 induces 2AG calcium flows into the cell via the CatSper channel, it can lead to hyperactivation. ABHD2 can be inhibited by testosterone, hydrocortisone, pristimerin and plant triterpenoids lupeol which may prevent premature hyperactivation. The acylglycerol lipase can catalyze the hydrolysis of endocannabinoid AG from cell membranes, which is dependent on progesterone. ABHD2 is highly expressed in spermatozoa, where it acts as a progesterone receptor to activate the acylglycerol lipase activity, mediating degradation of 1AG and 2AG to glycerol and AA. In addition, ABHD2 has a critical role in sperm capacitation in response to progesterone through mediating degradation of 2AG. It’s a suppressor of the sperm calcium channel CatSper, and it can result in calcium influx via CatSper and sperm activation. It may also play a role in smooth muscle cells migration.
Fig.1 ABHD2 regulates Ca2+ influx in human flagellum and involved in mouse acrosome reaction (Miller, 2016)
This article indicates that endogenous steroids and plant triterpenoids can influence CatSper activation via modulation of ABHD2.
This article shows that progesterone-activated endocannabinoid depletion by ABHD2 is a common mechanism.
This study indicates that ABHD2 is a new androgen-regulated gene that can promote prostate cancer growth and resistance to chemotherapy and is a novel target for diagnosis and treatment of prostate cancer.
This article demonstrates that ABHD2 and EREG are critical for HBV propagation and provides strong evidence that these proteins could be used as promising targets for anti-HBV drugs.
This article shows that ABHD2 plays a critical role in brain tumor progression.
We provide custom membrane protein preparation services for worldwide customers. Leveraging by our advanced Magic™ membrane protein production platform, we are able to present target membrane protein in multiple active formats. Our professional scientists are happy to help you find an ideal method and make your project a success. Aided by our versatile Magic™ anti-membrane protein antibody discovery platform, we also provide customized anti-ABHD2 antibody development services.
Creative Biolabs provides high-quality membrane protein preparation service to facilitate the development of worldwide customer’s research. During the past years, we have successfully established a powerful Magic™ membrane protein platform which enables us to provide a series of membrane protein preparation services. For more detailed information, please don’t hesitate to contact us.
Reference
All listed services and products are For Research Use Only. Do Not use in any diagnostic or therapeutic applications.