AMIGO1, encoded by the gene AMIGO1, is the abbreviation of Amphoterin-induced protein 1. AMIGO is a brain-enriched transmembrane immunoglobulin (Ig) superfamily protein. It consists of six extracellular leucine-rich repeats (LRR) and a single immunoglobulin-like (Ig) domain. It is a glycosylated protein widely expressed in the central nervous system (CNS) and can be found in neurons, oligodendrocytes as well as astrocytes.
Basic Information of AMIGO1 | |
Protein Name | Amphoterin-induced protein 1 |
Gene Name | AMIGO1 |
Aliases | Alivin-2, ALI2, AMIGO, KIAA1163 |
Organism | Homo sapiens (Human) |
UniProt ID | Q86WK6 |
Transmembrane Times | 1 |
Length (aa) | 493 |
Sequence | MHPHRDPRGLWLLLPSLSLLLFEVARAGRAVVSCPAACLCASNILSCSKQQLPNVPHSLPSYTALLDLSHNNLSRLRAEWTPTRLTQLHSLLLSHNHLNFISSEAFSPVPNLRYLDLSSNQLRTLDEFLFSDLQVLEVLLLYNNHIMAVDRCAFDDMAQLQKLYLSQNQISRFPLELVKEGAKLPKLTLLDLSSNKLKNLPLPDLQKLPAWIKNGLYLHNNPLNCDCELYQLFSHWQYRQLSSVMDFQEDLYCMNSKKLHNVFNLSFLNCGEYKERAWEAHLGDTLIIKCDTKQQGMTKVWVTPSNERVLDEVTNGTVSVSKDGSLLFQQVQVEDGGVYTCYAMGETFNETLSVELKVHNFTLHGHHDTLNTAYTTLVGCILSVVLVLIYLYLTPCRCWCRGVEKPSSHQGDSLSSSMLSTTPNHDPMAGGDKDDGFDRRVAFLEPAGPGQGQNGKLKPGNTLPVPEATGKGQRRMSDPESVSSVFSDTPIVV |
AMIGO1 promotes growth and fasciculation of neurites in cultured hippocampal neurons. It may be involved in myelination as well as fasciculation of developing neural axons. Also, it may have a role in regeneration as well as neural plasticity in the adult nervous system. It may mediate heterophilic cell-cell interaction as well as homophilic and contribute to signal transduction through its intracellular domain. AMIGO1 modulates the gating characteristics of the delayed rectifier voltage-dependent potassium channel KCNB1. In addition, AMIGO is associated with proaddiction adaptive response to chronic nicotine. It has been reported that AMIGO can interact with KCNB1 to form channel complex to mediate schizophrenia-related behavioral domains. It is necessary for the development of neural circuits of zebrafish. Furthermore, AMIGO1 plays a critical role in dendritic outgrowth during development, and it could modulate the adult neurons and survival of developing. AMIGO is specifically expressed on fiber tracts of neuronal tissues and participates in their formation.
Fig.1 Domain organization of representatives (AMIGO1 and other proteins). (Chen, 2006)
This article shows that AMIGO is associated with proaddiction adaptive responses to chronic nicotine.
This article demonstrates that AMIGO-Kv2.1 channel complex is involved in schizophrenia-related behavioral domains and identifies Kv2.1 (KCNB1) as a susceptibility gene which contributes to schizophrenia spectrum disorders in humans.
This study suggests that Amigo1 is necessary for the development of neural circuits of zebrafish via the mechanism by which regulation of the Kv2.1 channel to form functional neural circuitry and further controls locomotion.
This article shows that AMIGO1 plays a critical role in dendritic outgrowth during development, and it could modulate the adult neurons and survival of developing.
These studies suggest that the members of the AMIGO protein family are novel cell adhesion molecules among which AMIGO is specifically expressed on fiber tracts of neuronal tissues and participates in their formation.
We provide custom membrane protein preparation services for worldwide customers. Leveraging by our advanced Magic™ membrane protein production platform, we are able to present target membrane protein in multiple active formats. Our professional scientists are happy to help you find an ideal method and make your project a success. Aided by our versatile Magic™ anti-membrane protein antibody discovery platform, we also provide customized anti-AMIGO1 antibody development services.
Creative Biolabs provides high-quality membrane protein preparation service to facilitate the development of worldwide customer’s research. During the past years, we have successfully established a powerful Magic™ membrane protein platform which enables us to provide a series of membrane protein preparation services. For more detailed information, please feel free to contact us.
Reference
All listed services and products are For Research Use Only. Do Not use in any diagnostic or therapeutic applications.