Close

HPN Membrane Protein Introduction

Introduction of HPN

Serine protease hepsin, also known as transmembrane protease serine 1 or HPN, is a cell surface-expressed trypsin-like serine protease which is predominantly expressed in normal human liver. HPN in human is encoded by the HPN gene. And it belongs to the type II transmembrane serine protease (TTSP) family. Specifically, HPN contains an N-terminal cytoplasmic domain, a transmembrane domain, and an extracellular portion composed of a scavenger receptor-like cysteine-rich domain (SRCR domain) and a C-terminal protease domain with a trypsin-like fold (S1 domain).

Basic Information of HPN
Protein Name Serine protease hepsin
Gene Name HPN
Aliases Transmembrane protease serine 1
Organism Homo sapiens (Human)
UniProt ID P05981
TransmHPNrane Times 1
Length (aa) 417
Sequence MAQKEGGRTVPCCSRPKVAALTAGTLLLLTAIGAASWAIVAVLLRSDQEPLYPVQVSSADARLMVFDKTEGTWRLLCSSRSNARVAGLSCEEMGFLRALTHSELDVRTAGANGTSGFFCVDEGRLPHTQRLLEVISVCDCPRGRFLAAICQDCGRRKLPVDRIVGGRDTSLGRWPWQVSLRYDGAHLCGGSLLSGDWVLTAAHCFPERNRVLSRWRVFAGAVAQASPHGLQLGVQAVVYHGGYLPFRDPNSEENSNDIALVHLSSPLPLTEYIQPVCLPAAGQALVDGKICTVTGWGNTQYYGQQAGVLQEARVPIISNDVCNGADFYGNQIKPKMFCAGYPEGGIDACQGDSGGPFVCEDSISRTPRWRLCGIVSWGTGCALAQKPGVYTKVSDFREWIFQAIKTHSEASGMVTQL

Function of HPN Membrane Protein

Serine protease hepsin plays a role in cell growth and maintenance of cell morphology. And it is involved in the proteolytic processing of ACE2. It has been also shown that hepsin may mediate the proteolytic cleavage of urinary UMOD which is required for UMOD polymerization. Hepsin is prominently expressed in the human liver and several types of tumors, including prostate cancer, endometrial cancer, and renal cell carcinoma. It has been identified as one of the most highly up-regulated proteases in prostate cancer and immunohistochemical staining indicates its strong expression in late-stage tumors and metastatic bone lesions. Overexpression of hepsin in the prostate epithelium weakens the epithelial-stromal adhesion and disrupts the basement membrane. In preclinical studies using prostate cancer models, it has been shown that hepsin may play a role in invasive cancer growth, cancer progression. Hepsin has been also supposed to promote primary prostate cancer metastasis.

 Structure of Serine Protease Hepsin. Fig.1 Structure of Serine Protease Hepsin.

Application of HPN Membrane Protein in Literature

  1. Lee S.G., et al. RIPL peptide-conjugated nanostructured lipid carriers for enhanced intracellular drug delivery to hepsin-expressing cancer cells. Int J Nanomedicine. 2018, 13: 3263-3278. PubMed ID: 29910614

    Authors in this article considered the RIPL-NLCs as good candidates for Hpn-selective drug targeting with a high loading capacity of hydrophobic drug molecules.

  2. Pant S.M., et al. Analyzing the Type II Transmembrane Serine Protease Hepsin-Dependent Basement Membrane Remodeling in 3D Cell Culture. Methods Mol Biol. 2018, 1731: 169-178. PubMed ID: 29318553

    Authors in this article described how to establish a 3D mammary epithelial culture in an exogenous basement membrane-free egg white matrix and provided a protocol for quantitative analysis of the impact of hepsin on laminin-332 and its hemidesmosomal receptor α6-integrin by means of confocal microscopy imaging.

  3. Pant S.M., et al. Design, Synthesis, and Testing of Potent, Selective Hepsin Inhibitors via Application of an Automated Closed-Loop Optimization Platform. J Med Chem. 2018, 61(10): 4335-4347. PubMed ID: 29701962

    This article focused on rapidly developing potent and selective inhibitors of hepsin, using integrated design, synthesis, and screening platform.

  4. Nassan M., et al. Exploring hepsin functional genetic variation association with disease specific protein expression in bipolar disorder: Applications of a proteomic informed genomic approach. J Psychiatr Res. 2017, 95: 208-212. PubMed ID: 22753192

    This article attempted to study the potential functional role of serum Growth Differentiation Factor 15 (GDF15), Hepsin (HPN), and Matrix Metalloproteinase-7 (MMP7) in bipolar disorder (BP).

  5. Kwon H., et al. Recent Advances of Hepsin-Targeted Inhibitors. Curr Med Chem. 2017, 24(21): 2294-2311. PubMed ID: 28245763

    This article discussed design strategy, structure-activity relationship (SAR), and binding mode of the four classes of hepsin inhibitors.

HPN Preparation Options

Our versatile Magic™ membrane protein production platform enables many flexible options, from which you can always find a better match for your particular projects. To prepare the soluble and functional target protein of your interest, our experienced scientists present robust reconstitution forms as well as multiple active formats for membrane proteins. Aided by our versatile Magic™ anti-membrane protein antibody discovery platform, we also provide customized anti-HPN antibody development services.


As a reliable partner of the top global pharma companies and research agencies, Creative Biolabs has worked all out in the field of membrane protein preparation to provide the largest and most diverse portfolio of standard and custom professional membrane protein preparation services. Please feel free to contact us for more details and technical support.


All listed services and products are For Research Use Only. Do Not use in any diagnostic or therapeutic applications.

Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2024 Creative Biolabs. | Contact Us