Close
Close

Magic™ Membrane Protein Human ANXA5 (Annexin A5) for Antibody Discovery (CAT#: MP1395J)

Datasheet
This product is a 37.8 kDa Human ANXA5 membrane protein expressed in Yeast. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • ANXA5
  • Protein Length
  • Partial (2-320aa)
  • Protein Class
  • Ion Channel
  • Molecular Weight
  • 37.8 kDa
  • Sequence
  • AQVLRGTVTDFPGFDERADAETLRKAMKGLGTDEESILTLLTSRSNAQRQEISAAFKTLFGRDLLDDLKSELTGKFEKLIVALMKPSRLYDAYELKHALKGAGTNEKVLTEIIASRTPEELRAIKQVYEEEYGSSLEDDVVGDTSGYYQRMLVVLLQANRDPDAGIDEAQVEQDAQALFQAGELKWGTDEEKFITIFGTRSVSHLRKVFDKYMTISGFQIEETIDRETSGNLEQLLLAVVKSIRSIPAYLAETLYYAMKGAGTDDHTLIRVMVSRSEIDLFNIRKEFRKNFATSLYSMIKGDTSGDYKKALLLLCGEDD

Product Description

  • Expression Systems
  • Yeast
  • Tag
  • N-6xHis
  • Reconstitution
  • Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration).
  • Purity
  • >85% as determined by SDS-PAGE
  • Buffer
  • Liquid: Tris/PBS-based buffer, 5%-50% glycerol
    Lyophilized powder: Tris/PBS-based buffer, 6% Trehalose, pH 8.0

Target

  • Target Protein
  • ANXA5
  • Full Name
  • Annexin A5
  • Introduction
  • The Annexin 5 gene spans 29 kb containing 13 exons, and encodes a single transcript of approximately 1.6 kb and a protein product with a molecular weight of about 35 kDa.The protein encoded by this gene belongs to the annexin family of calcium-dependent phospholipid binding proteins some of which have been implicated in membrane-related events along exocytotic and endocytotic pathways. Annexin 5 is a phospholipase A2 and protein kinase C inhibitory protein with calcium channel activity and a potential role in cellular signal transduction, inflammation, growth and differentiation. Annexin 5 has also been described as placental anticoagulant protein I, vascular anticoagulant-alpha, endonexin II, lipocortin V, placental protein 4 and anchorin CII. Polymorphisms in this gene have been implicated in various obstetric complications.
  • Alternative Names
  • Anchorin CII; Annexin 5; Annexin A5; Annexin V; Annexin-5; Annexin5; AnnexinA5; AnnexinV; ANX 5; ANX A5; ANX5; ANXA5; ANXA5_HUMAN; Calphobindin I; CBP-I; Endonexin II; ENX 2; ENX2; Lipocortin V; PAP I; PAP-I; Placental anticoagulant protein 4; Placental anticoagulant protein I; PLACENTAL PROTEIN 4; PP 4; Pp4; RPRGL3; Thromboplastin inhibitor; VAC-alpha; Vascular anticoagulant-alpha

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2024 Creative Biolabs. | Contact Us