Close
Close

Magic™ Membrane Protein Human CD151 (CD151 molecule (Raph blood group)) Expressed in vitro E.coli expression system, Full Length (CAT#: MPX2307K)

Datasheet
This product is a Human CD151 membrane protein expressed in vitro E.coli expression system. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • CD151
  • Protein Length
  • Full Length
  • Protein Class
  • Receptor
  • TMD
  • 4
  • Sequence
  • MGEFNEKKTTCGTVCLKYLLFTYNCCFWLAGLAVMAVGIWTLALKSDYISLLASGTYLATAYILVVAGTVVMVTGVLGCCATFKERRNLLRLYFILLLIIFLLEIIAGILAYAYYQQLNTELKENLKDTMTKRYHQPGHEAVTSAVDQLQQEFHCCGSNNSQDWRDSEWIRSQEAGGRVVPDSCCKTVVALCGQRDHASNIYKVEGGCITKLETFIQEHLRVIGAVGIGIACVQVFGMIFTCCLYRSLKLEHY

Product Description

  • Expression Systems
  • in vitro E.coli expression system
  • Tag
  • 10xHis tag at the N-terminus
  • Protein Format
  • Soluble
  • Buffer
  • Tris/PBS-based buffer, 6% Trehalose, pH 8.0

Target

  • Target Protein
  • CD151
  • Full Name
  • CD151 molecule (Raph blood group)
  • Introduction
  • The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. This encoded protein is a cell surface glycoprotein that is known to complex with integrins and other transmembrane 4 superfamily proteins. It is involved in cellular processes including cell adhesion and may regulate integrin trafficking and/or function. This protein enhances cell motility, invasion and metastasis of cancer cells. Multiple alternatively spliced transcript variants that encode the same protein have been described for this gene.
  • Alternative Names
  • CD151; GP27; MER2; RAPH; SFA1; PETA-3; TSPAN24; CD151 antigen; CD151 antigen (Raph blood group); hemidesmosomal tetraspanin CD151; membrane glycoprotein SFA-1; platelet surface glycoprotein gp27; platelet-endothelial cell tetraspan antigen 3; platelet-endothelial tetraspan antigen 3; tetraspanin-24; tspan-24; CD151 molecule (Raph blood group)

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2024 Creative Biolabs. | Contact Us