Close

Magic™ Membrane Protein Human CD74 (CD74 molecule) Expressed in E.coli with 6xHis and Myc tag at the C-terminus for Antibody Discovery, Partial (73-232aa) (CAT#: MPX4208K)

This product is a 21.0 kDa Human CD74 membrane protein expressed in E.coli. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • CD74
  • Protein Length
  • Partial (73-232aa)
  • Protein Class
  • Immunity
  • Molecular Weight
  • 21.0 kDa
  • TMD
  • 1
  • Sequence
  • QQQGRLDKLTVTSQNLQLENLRMKLPKPPKPVSKMRMATPLLMQALPMGALPQGPMQNATKYGNMTEDHVMHLLQNADPLKVYPPLKGSFPENLRHLKNTMETIDWKVFESWMHHWLLFEMSRHSLEQKPTDAPPKVLTKCQEEVSHIPAVHPGSFRPKC

Product Description

  • Expression Systems
  • E.coli
  • Tag
  • 6xHis and Myc tag at the C-terminus
  • Protein Format
  • Soluble
  • Purity
  • >85% as determined by SDS-PAGE.
  • Buffer
  • Tris/PBS-based buffer, 6% Trehalose, pH 8.0

Target

  • Target Protein
  • CD74
  • Full Name
  • CD74 molecule
  • Introduction
  • The protein encoded by this gene associates with class II major histocompatibility complex (MHC) and is an important chaperone that regulates antigen presentation for immune response. It also serves as cell surface receptor for the cytokine macrophage migration inhibitory factor (MIF) which, when bound to the encoded protein, initiates survival pathways and cell proliferation. This protein also interacts with amyloid precursor protein (APP) and suppresses the production of amyloid beta (Abeta). Multiple alternatively spliced transcript variants encoding different isoforms have been identified.
  • Alternative Names
  • CD74; II; p33; DHLAG; HLADG; Ia-GAMMA; HLA class II histocompatibility antigen gamma chain; CD74 antigen (invariant polypeptide of major histocompatibility complex, class II antigen-associated); CD74 molecule, major histocompatibility complex, class II invariant chain; HLA-DR antigens-associated invariant chain; HLA-DR-gamma; a-associated invariant chain; MHC HLA-DR gamma chain; gamma chain of class II antigens; CD74 molecule

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2024 Creative Biolabs. | Contact Us