Close
Close

Magic™ Membrane Protein Human COX7A2 (Cytochrome c oxidase subunit 7A2) Full Length (CAT#: MPC2023K) Made to Order

Datasheet
This product is a 9.3 kDa Human COX7A2 membrane protein expressed in HEK293. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • COX7A2
  • Protein Length
  • Full length
  • Protein Class
  • Oxidoreductase
  • Molecular Weight
  • 9.3 kDa
  • TMD
  • 1
  • Sequence
  • MLRNLLALRQIGQRTISTASRRHFKNKVPEKQKLFQEDDEIPLYLKGGVA
    DALLYRATMILTVGGTAYAIYELAVASFPKKQE

Product Description

  • Expression Systems
  • HEK293
  • Tag
  • Flag-StrepII or based on specific requirements
  • Protein Format
  • Detergent or based on specific requirements

Target

  • Target Protein
  • COX7A2
  • Full Name
  • Cytochrome c oxidase subunit 7A2
  • Introduction
  • Cytochrome c oxidase, the terminal component of the mitochondrial respiratory chain, catalyzes the electron transfer from reduced cytochrome c to oxygen. This component is a heteromeric complex consisting of three catalytic subunits encoded by mitochondrial genes, and multiple structural subunits encoded by nuclear genes. The mitochondrially-encoded subunits function in electron transfer, while the nuclear-encoded subunits may function in the regulation and assembly of the complex. This nuclear gene encodes polypeptide 2 (liver isoform) of subunit VIIa, with this polypeptide being present in both muscle and non-muscle tissues. In addition to polypeptide 2, subunit VIIa includes polypeptide 1 (muscle isoform), which is present only in muscle tissues, and a related protein, which is present in all tissues. Alternative splicing results in multiple transcript variants. Related pseudogenes have been identified on chromosomes 4 and 14.
  • Alternative Names
  • COX7A2; VIIAL; COX7AL; COX7AL1; COXVIIAL; COXVIIa-L; cytochrome c oxidase subunit 7A2, mitochondrial; cytochrome c oxidase polypeptide 7A2, mitochondrial; cytochrome c oxidase polypeptide VIIa-liver/heart; cytochrome c oxidase subunit VIIa polypeptide 2 (liver); cytochrome c oxidase subunit VIIa-L; cytochrome c oxidase subunit VIIa-liver/heart; cytochrome c oxidase subunit VIIaL; hepatic cytochrome-c oxidase chain VIIa; Cytochrome c oxidase subunit 7A2

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2024 Creative Biolabs. | Contact Us