Close

Magic™ Membrane Protein Human COX8A (Cytochrome c oxidase subunit 8A) Full Length (CAT#: MPC1278K) Made to Order

This product is a 7.5 kDa Human COX8A membrane protein expressed in HEK293. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • COX8A
  • Protein Length
  • Full length
  • Protein Class
  • Transporter
  • Molecular Weight
  • 7.5 kDa
  • TMD
  • 1
  • Sequence
  • MSVLTPLLLRGLTGSARRLPVPRAKIHSLPPEGKLGIMELAVGLTSCFVT
    FLLPAGWILSHLETYRRPE

Product Description

  • Expression Systems
  • HEK293
  • Tag
  • Flag-StrepII or based on specific requirements
  • Protein Format
  • Detergent or based on specific requirements

Target

  • Target Protein
  • COX8A
  • Full Name
  • Cytochrome c oxidase subunit 8A
  • Introduction
  • The protein encoded by this gene is the terminal enzyme of the respiratory chain, coupling the transfer of electrons from cytochrome c to molecular oxygen, with the concomitant production of a proton electrochemical gradient across the inner mitochondrial membrane. In addition to 3 mitochondrially encoded subunits, which perform the catalytic function, the eukaryotic enzyme contains nuclear-encoded smaller subunits, ranging in number from 4 in some organisms to 10 in mammals. It has been proposed that nuclear-encoded subunits may be involved in the modulation of the catalytic function. This gene encodes one of the nuclear-encoded subunits.
  • Alternative Names
  • COX8A; COX; COX8; VIII; COX8L; COX8-2; VIII-L; MC4DN15; cytochrome c oxidase subunit 8A, mitochondrial; cytochrome c oxidase polypeptide VIII-liver/heart; cytochrome c oxidase subunit 8-2; cytochrome c oxidase subunit 8A (ubiquitous); cytochrome c oxidase subunit VIII; cytochrome c oxidase subunit VIIIA (ubiquitous); Cytochrome c oxidase subunit 8A

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2024 Creative Biolabs. | Contact Us