Close

Magic™ Membrane Protein Human DLK1 (Delta like non-canonical Notch ligand 1) Expressed in Mammalian cell expression system with Flag and Myc tag at the C-terminus for Antibody Discovery, Partial (24-303aa) (CAT#: MPX4581K)

This product is a 32.8 kDa Human DLK1 membrane protein expressed in Mammalian cell expression system. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • DLK1
  • Protein Length
  • Partial (24-303aa)
  • Protein Class
  • Receptor
  • Molecular Weight
  • 32.8 kDa
  • TMD
  • 1
  • Sequence
  • AECFPACNPQNGFCEDDNVCRCQPGWQGPLCDQCVTSPGCLHGLCGEPGQCICTDGWDGELCDRDVRACSSAPCANNRTCVSLDDGLYECSCAPGYSGKDCQKKDGPCVINGSPCQHGGTCVDDEGRASHASCLCPPGFSGNFCEIVANSCTPNPCENDGVCTDIGGDFRCRCPAGFIDKTCSRPVTNCASSPCQNGGTCLQHTQVSYECLCKPEFTGLTCVKKRALSPQQVTRLPSGYGLAYRLTPGVHELPVQQPEHRILKVSMKELNKKTPLLTEGQ

Product Description

  • Expression Systems
  • Mammalian cell expression system
  • Tag
  • Flag and Myc tag at the C-terminus
  • Protein Format
  • Soluble
  • Purity
  • >90% as determined by SDS-PAGE
  • Buffer
  • Tris-based buffer, 50% glycerol

Target

  • Target Protein
  • DLK1
  • Full Name
  • Delta like non-canonical Notch ligand 1
  • Introduction
  • This gene encodes a transmembrane protein that contains multiple epidermal growth factor repeats that functions as a regulator of cell growth. The encoded protein is involved in the differentiation of several cell types including adipocytes. This gene is located in a region of chromosome 14 frequently showing unparental disomy, and is imprinted and expressed from the paternal allele. A single nucleotide variant in this gene is associated with child and adolescent obesity and shows polar overdominance, where heterozygotes carrying an active paternal allele express the phenotype, while mutant homozygotes are normal.
  • Alternative Names
  • DLK1; DLK; FA1; ZOG; pG2; DLK-1; PREF1; Delta1; Pref-1; protein delta homolog 1; delta-like 1 homolog; fetal antigen 1; preadipocyte factor 1; secredeltin; Delta like non-canonical Notch ligand 1

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2024 Creative Biolabs. | Contact Us