Close

Magic™ Membrane Protein Human EPO (Erythropoietin) expressed in CHO with HPLC analyses for Antibody Discovery (CAT#: MP0066Q)

This product is a 37.0 kDa Human EPO membrane protein expressed in CHO. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • EPO
  • Protein Length
  • Partial
  • Protein Class
  • Druggable Genome, ES Cell Differentiation/IPS, Secreted Protein, Transmembrane
  • Molecular Weight
  • 37.0 kDa
  • Sequence
  • APPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYAWKRMEVGQQAVEVWQGLALLSEAVLRGQALLVNSSQPWEPLQLHVDKAVSGLRSLTTLLRALGAQKEAISPPDAASAAPL RTITADTFRKLFRVYSNFLRGKLKLYTGEACRTGDR

Product Description

  • Expression Systems
  • CHO
  • Purity
  • >90% pure by SDS-PAGE gel and HPLC analyses
  • Buffer
  • Lyophilized (0.2μ Sterile filtered) purified protein

Target

  • Target Protein
  • EPO
  • Full Name
  • Erythropoietin
  • Introduction
  • This gene encodes a secreted, glycosylated cytokine composed of four alpha helical bundles. The encoded protein is mainly synthesized in the kidney, secreted into the blood plasma, and binds to the erythropoietin receptor to promote red blood cell production, or erythropoiesis, in the bone marrow. Expression of this gene is upregulated under hypoxic conditions, in turn leading to increased erythropoiesis and enhanced oxygen-carrying capacity of the blood. Expression of this gene has also been observed in brain and in the eye, and elevated expression levels have been observed in diabetic retinopathy and ocular hypertension. Recombinant forms of the encoded protein exhibit neuroprotective activity against a variety of potential brain injuries, as well as antiapoptotic functions in several tissue types, and have been used in the treatment of anemia and to enhance the efficacy of cancer therapies.
  • Alternative Names
  • DBAL; ECYT5; EP; MVCD2; erythropoietin; epoetin

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2024 Creative Biolabs. | Contact Us