Close

Magic™ Membrane Protein Human GABRB2 (Gamma-aminobutyric acid type A receptor subunit beta2) Expressed in E.coli with 6xHis tag at the N-terminus for Antibody Discovery, Partial (26-244aa) (CAT#: MPX4117K)

This product is a 29.3 kDa Human GABRB2 membrane protein expressed in E.coli. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • GABRB2
  • Protein Length
  • Partial (26-244aa)
  • Protein Class
  • Transporter; Ion channel
  • Molecular Weight
  • 29.3 kDa
  • TMD
  • 4
  • Sequence
  • SVNDPSNMSLVKETVDRLLKGYDIRLRPDFGGPPVAVGMNIDIASIDMVSEVNMDYTLTMYFQQAWRDKRLSYNVIPLNLTLDNRVADQLWVPDTYFLNDKKSFVHGVTVKNRMIRLHPDGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIESYGYTTDDIEFYWRGDDNAVTGVTKIELPQFSIVDYKLITKKVVFSTGSYPRLSLSFKLKRNIGY

Product Description

  • Expression Systems
  • E.coli
  • Tag
  • 6xHis tag at the N-terminus
  • Protein Format
  • Soluble
  • Purity
  • >90% as determined by SDS-PAGE
  • Buffer
  • Tris/PBS-based buffer, 6% Trehalose, pH 8.0

Target

  • Target Protein
  • GABRB2
  • Full Name
  • Gamma-aminobutyric acid type A receptor subunit beta2
  • Introduction
  • The gamma-aminobutyric acid (GABA) A receptor is a multisubunit chloride channel that mediates the fastest inhibitory synaptic transmission in the central nervous system. This gene encodes GABA A receptor, beta 2 subunit. It is mapped to chromosome 5q34 in a cluster comprised of genes encoding alpha 1 and gamma 2 subunits of the GABA A receptor. Alternative splicing of this gene generates 2 transcript variants, differing by a 114 bp insertion.
  • Alternative Names
  • DEE92; ICEE2; gamma-aminobutyric acid receptor subunit beta-2; GABA(A) receptor subunit beta-2; gamma-aminobutyric acid A receptor beta 2; gamma-aminobutyric acid type A receptor beta2 subunit; GABRB2; Gamma-aminobutyric acid type A receptor subunit beta2

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2024 Creative Biolabs. | Contact Us