Close
Close

Magic™ Membrane Protein Human GLI2 (GLI family zinc finger 2) for Antibody Discovery (CAT#: MP1413J)

Datasheet
This product is a 30.5 kDa Human GLI2 membrane protein expressed in Mammalian cell. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • GLI2
  • Protein Length
  • Partial (412-641aa)
  • Protein Class
  • Ion Channel
  • Molecular Weight
  • 30.5 kDa
  • Sequence
  • EQLADLKEDLDRDDCKQEAEVVIYETNCHWEDCTKEYDTQEQLVHHINNEHIHGEKKEFVCRWQACTREQKPFKAQYMLVVHMRRHTGEKPHKCTFEGCSKAYSRLENLKTHLRSHTGEKPYVCEHEGCNKAFSNASDRAKHQNRTHSNEKPYICKIPGCTKRYTDPSSLRKHVKTVHGPDAHVTKKQRNDVHLRTPLLKENGDSEAGTEPGGPESTEASSTSQAVEDCL

Product Description

  • Expression Systems
  • Mammalian cell
  • Tag
  • N-6xHis
  • Reconstitution
  • Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration).
  • Purity
  • >85% as determined by SDS-PAGE
  • Buffer
  • Liquid: Tris/PBS-based buffer, 5%-50% glycerol
    Lyophilized powder: Tris/PBS-based buffer, 6% Trehalose, pH 8.0

Target

  • Target Protein
  • GLI2
  • Full Name
  • GLI family zinc finger 2
  • Introduction
  • This gene encodes a protein which belongs to the C2H2-type zinc finger protein subclass of the Gli family. Members of this subclass are characterized as transcription factors which bind DNA through zinc finger motifs. These motifs contain conserved H-C links. Gli family zinc finger proteins are mediators of Sonic hedgehog (Shh) signaling and they are implicated as potent oncogenes in the embryonal carcinoma cell. The protein encoded by this gene localizes to the cytoplasm and activates patched Drosophila homolog (PTCH) gene expression. It is also thought to play a role during embryogenesis. The encoded protein is associated with several phenotypes- Greig cephalopolysyndactyly syndrome, Pallister-Hall syndrome, preaxial polydactyly type IV, postaxial polydactyly types A1 and B.
  • Alternative Names
  • CJS; Gli 2; GLI family zinc finger 2; GLI Kruppel family member GLI2; GLI2; GLI2_HUMAN; Glioma associated oncogene family zinc finger; HPE9; Oncogene GLI2; PHS2; Tax helper protein 1; Tax helper protein 2; Tax helper protein; Tax responsive element 2 holding protein; Tax responsive element 25 bp sequence binding protein; THP; THP1; THP2; Zinc finger protein GLI2; CJS; HPE9; PHS2; THP1; THP2

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2024 Creative Biolabs. | Contact Us