Close

Magic™ Membrane Protein Human KCNE1 (Potassium voltage-gated channel subfamily E regulatory subunit 1) Expressed in vitro E.coli expression system, Full Length (CAT#: MPX3692K)

This product is a Human KCNE1 membrane protein expressed in vitro E.coli expression system. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • KCNE1
  • Protein Length
  • Full Length
  • Protein Class
  • Ion channel, Transport
  • TMD
  • 1
  • Sequence
  • MILSNTTAVTPFLTKLWQETVQQGGNMSGLARRSPRSSDGKLEALYVLMVLGFFGFFTLGIMLSYIRSKKLEHSNDPFNVYIESDAWQEKDKAYVQARVLESYRSCYVVENHLAIEQPNTHLPETKPSP

Product Description

  • Expression Systems
  • in vitro E.coli expression system
  • Tag
  • 10xHis tag at the N-terminus
  • Protein Format
  • Soluble
  • Buffer
  • Tris/PBS-based buffer, 6% Trehalose, pH 8.0

Target

  • Target Protein
  • KCNE1
  • Full Name
  • Potassium voltage-gated channel subfamily E regulatory subunit 1
  • Introduction
  • The product of this gene belongs to the potassium channel KCNE family. Potassium ion channels are essential to many cellular functions and show a high degree of diversity, varying in their electrophysiologic and pharmacologic properties. This gene encodes a transmembrane protein known to associate with the product of the KVLQT1 gene to form the delayed rectifier potassium channel. Mutation in this gene are associated with both Jervell and Lange-Nielsen and Romano-Ward forms of long-QT syndrome. Alternatively spliced transcript variants encoding the same protein have been identified.
  • Alternative Names
  • KCNE1; ISK; JLNS; LQT5; MinK; JLNS2; LQT2/5; IKs producing slow voltage-gated potassium channel subunit beta Mink; Long QT syndrome 5; cardiac delayed rectifier potassium channel protein; delayed rectifier potassium channel subunit IsK; minimal potassium channel; potassium channel, voltage gated subfamily E regulatory beta subunit 1; potassium voltage-gated channel, Isk-related family, member 1; potassium voltage-gated channel, Isk-related subfamily, member 1; voltage gated potassiun channel accessory subunit; Potassium voltage-gated channel subfamily E regulatory subunit 1

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2024 Creative Biolabs. | Contact Us