Close

Magic™ Membrane Protein Human HFE (Homeostatic iron regulator) Expressed in E.coli for Antibody Discovery, Partial (23-306aa) (CAT#: MPX0133K)

This product is a 36 kDa Human HFE membrane protein expressed in E.coli. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • HFE
  • Protein Length
  • Partial (23-306aa)
  • Protein Class
  • Transporter
  • Molecular Weight
  • 36 kDa
  • TMD
  • 1
  • Sequence
  • MGSSHHHHHHSSGLVPRGSHMGSMRLLRSHSLHYLFMGASEQDLGLSLFEALGYVDDQLFVFYDHESRRVEPRTPWVSSRISSQMWLQLSQSLKGWDHMFTVDFWTIMENHNHSKESHTLQVILGCEMQEDNSTEGYWKYGYDGQDHLEFCPDTLDWRAAEPRAWPTKLEWERHKIRARQNRAYLERDCPAQLQQLLELGRGVLDQQVPPLVKVTHHVTSSVTTLRCRALNYYPQNITMKWLKDKQPMDAKEFEPKDVLPNGDGTYQGWITLAVPPGEEQRYTCQVEHPGLDQPLIVIWEPSPSGTLV

Product Description

  • Expression Systems
  • E.coli
  • Tag
  • His tag at the N-terminus
  • Protein Format
  • Soluble
  • Purity
  • > 85 % SDS-PAGE.
  • Buffer
  • pH: 8.00, Constituents: 2.4% Urea, 0.32% Tris HCl, 10% Glycerol (glycerin, glycerine)

Target

  • Target Protein
  • HFE
  • Full Name
  • Homeostatic iron regulator
  • Introduction
  • The protein encoded by this gene is a membrane protein that is similar to MHC class I-type proteins and associates with beta2-microglobulin (beta2M). It is thought that this protein functions to regulate iron absorption by regulating the interaction of the transferrin receptor with transferrin. The iron storage disorder, hereditary haemochromatosis, is a recessive genetic disorder that results from defects in this gene. At least nine alternatively spliced variants have been described for this gene. Additional variants have been found but their full-length nature has not been determined.
  • Alternative Names
  • HFE; HH; HFE1; HLA-H; MVCD7; TFQTL2; hereditary hemochromatosis protein; MHC class I-like protein HFE; hereditary hemochromatosis protein HLA-H; high Fe; Homeostatic iron regulator

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2024 Creative Biolabs. | Contact Us