Close

Magic™ Membrane Protein Human HLA-G (Major histocompatibility complex, class I, G) Expressed in E.coli with 6xHis and SUMO tag at the N-terminus for Antibody Discovery, Partial (25-308aa) (CAT#: MPX4232K)

This product is a 48.7kDa Human HLA-G membrane protein expressed in E.coli. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • HLA-G
  • Protein Length
  • Partial (25-308aa)
  • Protein Class
  • Immunity
  • Molecular Weight
  • 48.7kDa
  • TMD
  • 1
  • Sequence
  • GSHSMRYFSAAVSRPGRGEPRFIAMGYVDDTQFVRFDSDSACPRMEPRAPWVEQEGPEYWEEETRNTKAHAQTDRMNLQTLRGYYNQSEASSHTLQWMIGCDLGSDGRLLRGYEQYAYDGKDYLALNEDLRSWTAADTAAQISKRKCEAANVAEQRRAYLEGTCVEWLHRYLENGKEMLQRADPPKTHVTHHPVFDYEATLRCWALGFYPAEIILTWQRDGEDQTQDVELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPLMLRWKQSSLPTIPI

Product Description

  • Expression Systems
  • E.coli
  • Tag
  • 6xHis and SUMO tag at the N-terminus
  • Protein Format
  • Soluble
  • Purity
  • >85% as determined by SDS-PAGE.
  • Buffer
  • Tris/PBS-based buffer, 6% Trehalose, pH 8.0

Target

  • Target Protein
  • HLA-G
  • Full Name
  • Major histocompatibility complex, class I, G
  • Introduction
  • HLA-G belongs to the HLA class I heavy chain paralogues. This class I molecule is a heterodimer consisting of a heavy chain and a light chain (beta-2 microglobulin). The heavy chain is anchored in the membrane. HLA-G is expressed on fetal derived placental cells. The heavy chain is approximately 45 kDa and its gene contains 8 exons. Exon one encodes the leader peptide, exons 2 and 3 encode the alpha1 and alpha2 domain, which both bind the peptide, exon 4 encodes the alpha3 domain, exon 5 encodes the transmembrane region, and exon 6 encodes the cytoplasmic tail.
  • Alternative Names
  • HLA-G; MHC-G; HLA class I histocompatibility antigen, alpha chain G; HLA G antigen; HLA-G histocompatibility antigen, class I, G; MHC class I antigen G; MHC class Ib antigen; b2 microglobulin; mutant MHC class I antigen; mutant MHC class Ib antigen; Major histocompatibility complex, class I, G

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2024 Creative Biolabs. | Contact Us