Close
Close

Magic™ Membrane Protein Human KCND2 (Potassium voltage-gated channel subfamily D member 2) for Antibody Discovery (CAT#: MP1370J)

Datasheet
This product is a 27 kDa Human KCND2 membrane protein expressed in Yeast. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • KCND2
  • Protein Length
  • Partial (406-630aa)
  • Protein Class
  • Ion Channel
  • Molecular Weight
  • 27 kDa
  • Sequence
  • VSNFSRIYHQNQRADKRRAQKKARLARIRAAKSGSANAYMQSKRNGLLSNQLQSSEDEQAFVSKSGSSFETQHHHLLHCLEKTTNHEFVDEQVFEESCMEVATVNRPSSHSPSLSSQQGVTSTCCSRRHKKTFRIPNANVSGSHQGSIQELSTIQIRCVERTPLSNSRSSLNAKMEECVKLNCEQPYVTTAIISIPTPPVTTPEGDDRPESPEYSGGNIVRVSAL

Product Description

  • Expression Systems
  • Yeast
  • Tag
  • N-6xHis
  • Reconstitution
  • Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration).
  • Purity
  • >90% as determined by SDS-PAGE
  • Buffer
  • Liquid: Tris/PBS-based buffer, 5%-50% glycerol
    Lyophilized powder: Tris/PBS-based buffer, 6% Trehalose, pH 8.0

Target

  • Target Protein
  • KCND2
  • Full Name
  • Potassium voltage-gated channel subfamily D member 2
  • Introduction
  • Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. Four sequence-related potassium channel genes - shaker, shaw, shab, and shal - have been identified in Drosophila, and each has been shown to have human homolog(s). This gene encodes a member of the potassium channel, voltage-gated, shal-related subfamily, members of which form voltage-activated A-type potassium ion channels and are prominent in the repolarization phase of the action potential. This member mediates a rapidly inactivating, A-type outward potassium current which is not under the control of the N terminus as it is in Shaker channels.
  • Alternative Names
  • KCD2; KCND 2; KCND2; KCND2_HUMAN; KIAA1044; MGC119702; MGC119703; Potassium voltage gated channel Shal related subfamily member 2; Potassium voltage-gated channel subfamily D member 2; RK 5; RK5; Voltage gated potassium channel Kv4.2; Voltage gated potassium channel subunit Kv4.2; Voltage sensitive potassium channel; Voltage-gated potassium channel subunit Kv4.2

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2024 Creative Biolabs. | Contact Us