Close
Close

Magic™ Membrane Protein Human KCNJ10 (Potassium inwardly rectifying channel subfamily J member 10) Expressed in vitro E.coli expression system, Full Length (CAT#: MPX0935K)

Datasheet
This product is a Human KCNJ10 membrane protein expressed in vitro E.coli expression system. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • KCNJ10
  • Protein Length
  • Full Length
  • Protein Class
  • Ion channel, Transport
  • Molecular Weight
  • 58.5 kDa
  • TMD
  • 2
  • Sequence
  • MTSVAKVYYSQTTQTESRPLMGPGIRRRRVLTKDGRSNVRMEHIADKRFLYLKDLWTTFIDMQWRYKLLLFSATFAGTWFLFGVVWYLVAVAHGDLLELDPPANHTPCVVQVHTLTGAFLFSLESQTTIGYGFRYISEECPLAIVLLIAQLVLTTILEIFITGTFLAKIARPKKRAETIRFSQHAVVASHNGKPCLMIRVANMRKSLLIGCQVTGKLLQTHQTKEGENIRLNQVNVTFQVDTASDSPFLILPLTFYHVVDETSPLKDLPLRSGEGDFELVLILSGTVESTSATCQVRTSYLPEEILWGYEFTPAISLSASGKYIADFSLFDQVVKVASPSGLRDSTVRYGDPEKLKLEESLREQAEKEGSALSVRISNV

Product Description

  • Expression Systems
  • in vitro E.coli expression system
  • Tag
  • 6xHis and SUMO tag at the N-terminus
  • Protein Format
  • Soluble
  • Purity
  • >90% as determined by SDS-PAGE.
  • Buffer
  • Tris/PBS-based buffer, 6% Trehalose, pH 8.0

Target

  • Target Protein
  • KCNJ10
  • Full Name
  • Potassium inwardly rectifying channel subfamily J member 10
  • Introduction
  • This gene encodes a member of the inward rectifier-type potassium channel family, characterized by having a greater tendency to allow potassium to flow into, rather than out of, a cell. The encoded protein may form a heterodimer with another potassium channel protein and may be responsible for the potassium buffering action of glial cells in the brain. Mutations in this gene have been associated with seizure susceptibility of common idiopathic generalized epilepsy syndromes.
  • Alternative Names
  • KCNJ10; KIR1.2; KIR4.1; SESAME; BIRK-10; KCNJ13-PEN; ATP-sensitive inward rectifier potassium channel 10; ATP-dependent inwardly rectifying potassium channel Kir4.1; glial ATP-dependent; inwardly rectifying potassium channel KIR4.1; inward rectifier K(+) channel Kir1.2; inward rectifier K+ channel KIR1.2; potassium channel, inwardly rectifying subfamily J member 10; potassium voltage-gated channel subfamily J member 10; Potassium inwardly rectifying channel subfamily J member 10

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2024 Creative Biolabs. | Contact Us