Close

Magic™ Membrane Protein Human KCNK10 (Potassium two pore domain channel subfamily K member 10) Expressed in Wheat germ for Antibody Discovery, Partial (276-379aa) (CAT#: MPX0061K)

This product is a 37 kDa Human KCNK10 membrane protein expressed in Wheat germ. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • KCNK10
  • Protein Length
  • Partial (276-379aa)
  • Protein Class
  • Transporter; Ion channel
  • Molecular Weight
  • 37 kDa
  • TMD
  • 4
  • Sequence
  • DFELVLILSGTVESTSATCQVRTSYLPEEILWGYEFTPAISLSASGKYIADFSLFDQVVKVASPSGLRDSTVRYGDPEKLKLEESLREQAEKEGSALSVRISNV

Product Description

  • Expression Systems
  • Wheat germ
  • Protein Format
  • Soluble
  • Endotoxin
  • <0.1 EU/μg by the LAL method
  • Buffer
  • pH: 8.00, Constituents: 0.31% Glutathione, 0.79% Tris HCl

Target

  • Target Protein
  • KCNK10
  • Full Name
  • Potassium two pore domain channel subfamily K member 10
  • Introduction
  • The protein encoded by this gene belongs to the family of potassium channel proteins containing two pore-forming P domains. This channel is an open rectifier which primarily passes outward current under physiological K+ concentrations, and is stimulated strongly by arachidonic acid and to a lesser degree by membrane stretching, intracellular acidification, and general anaesthetics. Several alternatively spliced transcript variants encoding different isoforms have been identified for this gene.
  • Alternative Names
  • TREK2; TREK-2; K2p10.1; PPP1R97; potassium channel subfamily K member 10; 2P domain potassium channel TREK2; TREK-2 K(+) channel subunit; TWIK-related K+ channel 2; outward rectifying potassium channel protein TREK-2; potassium channel TREK-2; potassium channel, subfamily K, member 10; potassium channel, two pore domain subfamily K, member 10; protein phosphatase 1, regulatory subunit 97; KCNK10; Potassium two pore domain channel subfamily K member 10

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2024 Creative Biolabs. | Contact Us