Close

Magic™ Membrane Protein Human MUC21 (Mucin 21, cell surface associated) Expressed in E.coli with Tag-Free for Antibody Discovery, Partial (501-566aa) (CAT#: MPX4137K)

This product is a 7.3 kDa Human MUC21 membrane protein expressed in E.coli. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • MUC21
  • Protein Length
  • Partial (501-566aa)
  • Protein Class
  • Receptor
  • Molecular Weight
  • 7.3 kDa
  • TMD
  • 1
  • Sequence
  • CVRNSLSLRNTFNTAVYHPHGLNHGLGPGPGGNHGAPHRPRWSPNWFWRRPVSSIAMEMSGRNSGP

Product Description

  • Expression Systems
  • E.coli
  • Tag
  • Tag-Free
  • Protein Format
  • Soluble
  • Purity
  • >85% as determined by SDS-PAGE.
  • Buffer
  • Tris/PBS-based buffer, 6% Trehalose, pH 8.0

Target

  • Target Protein
  • MUC21
  • Full Name
  • Mucin 21, cell surface associated
  • Introduction
  • This gene encodes a large membrane-bound glycoprotein which is a member of the mucin family. Mucins are O-glycosylated proteins that play an essential role in forming protective mucous barriers on epithelial surfaces. These proteins also play a role in intracellular signaling. The encoded protein contains an N-terminal signal sequence, an extracellular mucin domain, a stem domain, a transmembrane domain, and a C-terminal cytoplasmic tail domain. The mucin domain contains O-glycosylation sites and is polymorphic with isoforms containing a variable number of nonidentical proline-, threonine-, and serine-rich tandem repeats of 15 amino acids each. The aberrent expression of this gene is associated with lung adenocarcinoma.
  • Alternative Names
  • MUC21; MUC-21; KMQK697; C6orf205; mucin-21; epiglycanin; Mucin 21, cell surface associated

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2024 Creative Biolabs. | Contact Us