Close

Magic™ Membrane Protein Human NDUFB6 (NADH:ubiquinone oxidoreductase subunit B6) Expressed in vitro E.coli expression system, Full Length of Mature Protein (CAT#: MPX1113K)

This product is a Human NDUFB6 membrane protein expressed in vitro E.coli expression system. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • NDUFB6
  • Protein Length
  • Full Length of Mature Protein
  • Protein Class
  • Transport
  • TMD
  • 1
  • Sequence
  • TGYTPDEKLRLQQLRELRRRWLKDQELSPREPVLPPQKMGPMEKFWNKFLENKSPWRKMVHGVYKKSIFVFTHVLVPVWIIHYYMKYHVSEKPYGIVEKKSRIFPGDTILETGEVIPPMKEFPDQHH

Product Description

  • Expression Systems
  • in vitro E.coli expression system
  • Tag
  • 10xHis tag at the N-terminus
  • Protein Format
  • Soluble
  • Buffer
  • Tris/PBS-based buffer, 6% Trehalose, pH 8.0

Target

  • Target Protein
  • NDUFB6
  • Full Name
  • NADH:ubiquinone oxidoreductase subunit B6
  • Introduction
  • The protein encoded by this gene is a subunit of the multisubunit NADH:ubiquinone oxidoreductase (complex I). Mammalian complex I is composed of 45 different subunits. It locates at the mitochondrial inner membrane. This protein has NADH dehydrogenase activity and oxidoreductase activity. It transfers electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone. Alternative splicing occurs at this locus and three transcript variants encoding distinct isoforms have been identified.
  • Alternative Names
  • NDUFB6; CI; B17; NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6; CI-B17; NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 6, 17kDa; NADH-ubiquinone oxidoreductase B17 subunit; NADH-ubiquinone oxidoreductase beta subunit, 6; complex I, mitochondrial respiratory chain, B17 subunit; complex I-B17; NADH:ubiquinone oxidoreductase subunit B6

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2024 Creative Biolabs. | Contact Us