Close

Magic™ Membrane Protein Human NDUFS4 (NADH:ubiqui oxidoreductase subunit S4) for Antibody Discovery (CAT#: MP0782X)

This product is a 44.99 kDa Human NDUFS4 membrane protein expressed in in vitro wheat germ expression system. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • NDUFS4
  • Protein Length
  • Full-length
  • Molecular Weight
  • 44.99 kDa
  • Sequence
  • MAAVSMSVVLRQTLWRRRAVAVAALSVSRVPTRSLRTSSWRLAQDQTQDTQLITVDEKLDITTLTGVPEEHIKTRKVRIFVPARNNMQSGVNNTKKWKMEFDTRERWENPLMGWASTADPLSNMVLTFSTKEDAVSFAEKNGWSYDIEERKVPKPKSKSYGANFSWNKRTRVSTK

Product Description

  • Application
  • Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein), Antibody Production, Protein Array
  • Expression Systems
  • in vitro wheat germ expression system
  • Tag
  • GST-tag at N-terminal
  • Purification
  • Glutathione Sepharose 4 Fast Flow
  • Buffer
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer

Target

  • Target Protein
  • NDUFS4
  • Full Name
  • NADH:ubiqui oxidoreductase subunit S4
  • Introduction
  • This gene encodes an nuclear-encoded accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (complex I, or NADH:ubiqui oxidoreductase). Complex I removes electrons from NADH and passes them to the electron acceptor ubiqui. Mutations in this gene can cause mitochondrial complex I deficiencies such as Leigh syndrome. Alternative splicing results in multiple transcript variants.
  • Alternative Names
  • AQDQ; CI-18; MC1DN1; CI-AQDQ; CI-18 kDa; NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial; NADH dehydrogenase (ubiquinone) Fe-S protein 4, 18kDa (NADH-coenzyme Q reductase); NADH-ubiquinone oxidoreductase 18 kDa subunit; complex I 18kDa subunit; complex I-AQDQ; mitochondrial respiratory chain complex I (18-KD subunit); CI-AQDQ; NADH-ubiquinone oxidoreductase 18 kDa subunit

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2024 Creative Biolabs. | Contact Us