Close
Close

Magic™ Membrane Protein Human PEX3 (Peroxisomal biogenesis factor 3) Expressed in E.coli with 10xHis tag at the N-terminus, Myc tag at the C-terminus for Antibody Discovery, Partial (141-373aa) (CAT#: MPX4131K)

Datasheet
This product is a 33.3 kDa Human PEX3 membrane protein expressed in E.coli. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • PEX3
  • Protein Length
  • Partial (141-373aa)
  • Protein Class
  • Receptor
  • Molecular Weight
  • 33.3 kDa
  • TMD
  • 2
  • Sequence
  • YLDNAAVGKNGTTILAPPDVQQQYLSSIQHLLGDGLTELITVIKQAVQKVLGSVSLKHSLSLLDLEQKLKEIRNLVEQHKSSSWINKDGSKPLLCHYMMPDEETPLAVQACGLSPRDITTIKLLNETRDMLESPDFSTVLNTCLNRGFSRLLDNMAEFFRPTEQDLQHGNSMNSLSSVSLPLAKIIPIVNGQIHSVCSETPSHFVQDLLTMEQVKDFAANVYEAFSTPQQLEK

Product Description

  • Expression Systems
  • E.coli
  • Tag
  • 10xHis tag at the N-terminus, Myc tag at the C-terminus
  • Protein Format
  • Soluble
  • Purity
  • >85% as determined by SDS-PAGE.
  • Buffer
  • Tris/PBS-based buffer, 6% Trehalose, pH 8.0

Target

  • Target Protein
  • PEX3
  • Full Name
  • Peroxisomal biogenesis factor 3
  • Introduction
  • The product of this gene is involved in peroxisome biosynthesis and integrity. It assembles membrane vesicles before the matrix proteins are translocated. Peroxins (PEXs) are proteins that are essential for the assembly of functional peroxisomes. The peroxisome biogenesis disorders (PBDs) are a group of genetically heterogeneous autosomal recessive, lethal diseases characterized by multiple defects in peroxisome function. The peroxisomal biogenesis disorders are a heterogeneous group with at least 14 complementation groups and with more than 1 phenotype being observed in cases falling into particular complementation groups. Although the clinical features of PBD patients vary, cells from all PBD patients exhibit a defect in the import of one or more classes of peroxisomal matrix proteins into the organelle. Defects in this gene are a cause Zellweger syndrome (ZWS).
  • Alternative Names
  • PEX3; TRG18; PBD10A; PBD10B; peroxin-3; peroxisomal assembly protein PEX3; transformation-related protein 18; Peroxisomal biogenesis factor 3

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2024 Creative Biolabs. | Contact Us