Close

Magic™ Membrane Protein Human PLPP2 (Phospholipid phosphatase 2) Expressed in vitro E.coli expression system, Full Length (CAT#: MPX2673K)

This product is a Human PLPP2 membrane protein expressed in vitro E.coli expression system. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • PLPP2
  • Protein Length
  • Full Length
  • Protein Class
  • Receptor
  • TMD
  • 6
  • Sequence
  • MQRRWVFVLLDVLCLLVASLPFAILTLVNAPYKRGFYCGDDSIRYPYRPDTITHGLMAGVTITATVILVSAGEAYLVYTDRLYSRSDFNNYVAAVYKVLGTFLFGAAVSQSLTDLAKYMIGRLRPNFLAVCDPDWSRVNCSVYVQLEKVCRGNPADVTEARLSFYSGHSSFGMYCMVFLALYVQARLCWKWARLLRPTVQFFLVAFALYVGYTRVSDYKHHWSDVLVGLLQGALVAALTVCYISDFFKARPPQHCLKEEELERKPSLSLTLTLGEADHNHYGYPHSSS

Product Description

  • Expression Systems
  • in vitro E.coli expression system
  • Tag
  • 10xHis tag at the N-terminus
  • Protein Format
  • Soluble
  • Buffer
  • Tris/PBS-based buffer, 6% Trehalose, pH 8.0

Target

  • Target Protein
  • PLPP2
  • Full Name
  • Phospholipid phosphatase 2
  • Introduction
  • The protein encoded by this gene is a member of the phosphatidic acid phosphatase (PAP) family. PAPs convert phosphatidic acid to diacylglycerol, and function in de novo synthesis of glycerolipids as well as in receptor-activated signal transduction mediated by phospholipase D. This protein is similar to phosphatidic acid phosphatase type 2A (PPAP2A) and type 2B (PPAP2B). All three proteins contain 6 transmembrane regions, and a consensus N-glycosylation site. This protein has been shown to possess membrane associated PAP activity. Three alternatively spliced transcript variants encoding distinct isoforms have been reported.
  • Alternative Names
  • PLPP2; LPP2; PAP-2c; PAP2-g; PPAP2C; PAP2-gamma; PAP2c; lipid phosphate phosphohydrolase 2; phosphatidate phosphohydrolase type 2c; phosphatidic acid phosphatase 2c; phosphatidic acid phosphatase type 2C; phosphatidic acid phosphohydrolase type 2c; type-2 phosphatidic acid phosphatase-gamma; Phospholipid phosphatase 2

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2024 Creative Biolabs. | Contact Us