Close
Close

Magic™ Membrane Protein Human GYPA (Glycophorin A (MNS blood group)) Expressed in Yeast with 6xHis tag at the N-terminus for Antibody Discovery, Partial (20-91aa) (CAT#: MPX4216K)

Datasheet
This product is a 9.9kDa Human GYPA membrane protein expressed in Yeast. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • GYPA
  • Protein Length
  • Partial (20-91aa)
  • Protein Class
  • Receptor
  • Molecular Weight
  • 9.9kDa
  • TMD
  • 1
  • Sequence
  • LSTTEVAMHTSTSSSVTKSYISSQTNDTHKRDTYAATPRAHEVSEISVRTVYPPEEETGERVQLAHHFSEPE

Product Description

  • Expression Systems
  • Yeast
  • Tag
  • 6xHis tag at the N-terminus
  • Protein Format
  • Soluble
  • Purity
  • >90% as determined by SDS-PAGE
  • Buffer
  • Tris/PBS-based buffer, 6% Trehalose, pH 8.0

Target

  • Target Protein
  • GYPA
  • Full Name
  • Glycophorin A (MNS blood group)
  • Introduction
  • Glycophorins A (GYPA) and B (GYPB) are major sialoglycoproteins of the human erythrocyte membrane which bear the antigenic determinants for the MN and Ss blood groups. In addition to the M or N and S or s antigens that commonly occur in all populations, about 40 related variant phenotypes have been identified. These variants include all the variants of the Miltenberger complex and several isoforms of Sta, as well as Dantu, Sat, He, Mg, and deletion variants Ena, S-s-U- and Mk. Most of the variants are the result of gene recombinations between GYPA and GYPB.
  • Alternative Names
  • GYPA; MN; GPA; MNS; GPSAT; PAS-2; CD235a; GPErik; HGpMiV; HGpMiXI; HGpSta(C); glycophorin-A; MN sialoglycoprotein; Mi.V glycoprotein (24 AA); erythroid-lineage-specific membrane; sialoglycoprotein; glycophorin A (MN blood group); glycophorin A, GPA; glycophorin Erik; glycophorin MiI; glycophorin MiV; glycophorin SAT; glycophorin Sta type C; recombinant glycophorin A-B Miltenberger-DR; sialoglycoprotein alpha; Glycophorin A (MNS blood group)

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2024 Creative Biolabs. | Contact Us