Close

Magic™ Membrane Protein Human PLPPR5 (Phospholipid phosphatase related 5) Expressed in vitro E.coli expression system, Full Length (CAT#: MPX2715K)

This product is a Human PLPPR5 membrane protein expressed in vitro E.coli expression system. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • PLPPR5
  • Protein Length
  • Full Length
  • Protein Class
  • Receptor
  • TMD
  • 6
  • Sequence
  • MPLLPAALTSSMLYFQMVIMAGTVMLAYYFEYTDTFTVNVQGFFCHDSAYRKPYPGPEDSSAVPPVLLYSLAAGVPVLVIIVGETAVFCLQLATRDFENQEKTILTGDCCYINPLVRRTVRFLGIYTFGLFATDIFVNAGQVVTGNLAPHFLALCKPNYTALGCQQYTQFISGEEACTGNPDLIMRARKTFPSKEAALSVYAAMYLTMYITNTIKAKGTRLAKPVLCLGLMCLAFLTGLNRVAEYRNHWSDVIAGFLVGISIAVFLVVCVVNNFKGRQAENEHIHMDNLAQMPMISIPRVESPLEKVTSVQNHITAFAEVT

Product Description

  • Expression Systems
  • in vitro E.coli expression system
  • Tag
  • 10xHis tag at the N-terminus
  • Protein Format
  • Soluble
  • Buffer
  • Tris/PBS-based buffer, 6% Trehalose, pH 8.0

Target

  • Target Protein
  • PLPPR5
  • Full Name
  • Phospholipid phosphatase related 5
  • Introduction
  • The protein encoded by this gene is a type 2 member of the phosphatidic acid phosphatase (PAP) family. All type 2 members of this protein family contain 6 transmembrane regions, and a consensus N-glycosylation site. PAPs convert phosphatidic acid to diacylglycerol, and function in de novo synthesis of glycerolipids as well as in receptor-activated signal transduction mediated by phospholipase D. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.
  • Alternative Names
  • PLPPR5; PAP2; PRG5; LPPR5; PAP2D; phospholipid phosphatase-related protein type 5; PRG-5; lipid phosphate phosphatase-related protein type 5; phosphatidic acid phosphatase 2d; phosphatidic acid phosphatase type 2; phosphatidic acid phosphatase type 2d; plasticity-related gene 5 protein; plasticity-related protein 5; Phospholipid phosphatase related 5

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2024 Creative Biolabs. | Contact Us