Close

Magic™ Membrane Protein Human SDHC (Succinate dehydrogenase complex subunit C) Expressed in vitro E.coli expression system, Full Length of Mature Protein (CAT#: MPX1148K)

This product is a Human SDHC membrane protein expressed in vitro E.coli expression system. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • SDHC
  • Protein Length
  • Full Length of Mature Protein
  • Protein Class
  • Transport
  • TMD
  • 3
  • Sequence
  • LGTTAKEEMERFWNKNIGSNRPLSPHITIYSWSLPMAMSICHRGTGIALSAGVSLFGMSALLLPGNFESYLELVKSLCLGPALIHTAKFALVFPLMYHTWNGIRHLMWDLGKGLKIPQLYQSGVVVLVLTVLSSMGLAAM

Product Description

  • Expression Systems
  • in vitro E.coli expression system
  • Tag
  • 10xHis tag at the N-terminus
  • Protein Format
  • Soluble
  • Buffer
  • Tris/PBS-based buffer, 6% Trehalose, pH 8.0

Target

  • Target Protein
  • SDHC
  • Full Name
  • Succinate dehydrogenase complex subunit C
  • Introduction
  • This gene encodes one of four nuclear-encoded subunits that comprise succinate dehydrogenase, also known as mitochondrial complex II, a key enzyme complex of the tricarboxylic acid cycle and aerobic respiratory chains of mitochondria. The encoded protein is one of two integral membrane proteins that anchor other subunits of the complex, which form the catalytic core, to the inner mitochondrial membrane. There are several related pseudogenes for this gene on different chromosomes. Mutations in this gene have been associated with paragangliomas. Alternatively spliced transcript variants have been described.
  • Alternative Names
  • SDHC; CYBL; PGL3; QPS1; SDH3; CYB560; succinate dehydrogenase cytochrome b560 subunit, mitochondrial; cytochrome B large subunit of complex II; integral membrane protein CII-3b; large subunit of cytochrome b; succinate dehydrgenase cytochrome b; succinate dehydrogenase 3, integral membrane subunit; succinate dehydrogenase complex subunit C integral membrane protein 15kDa; succinate dehydrogenase complex, subunit C, integral membrane protein, 15kD; succinate-ubiquinone oxidoreductase cytochrome B large subunit; Succinate dehydrogenase complex subunit C

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2024 Creative Biolabs. | Contact Us