Close

Magic™ Membrane Protein Human SFTPA2 (Surfactant protein A2) Expressed in vitro E.coli expression system, Full Length of Mature Protein (CAT#: MPX0966K)

This product is a Human SFTPA2 membrane protein expressed in vitro E.coli expression system. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • SFTPA2
  • Protein Length
  • Full Length of Mature Protein
  • Protein Class
  • Receptor
  • Molecular Weight
  • 41.1kDa
  • Sequence
  • EVKDVCVGSPGIPGTPGSHGLPGRDGRDGVKGDPGPPGPMGPPGETPCPPGNNGLPGAPGVPGERGEKGEAGERGPPGLPAHLDEELQATLHDFRHQILQTRGALSLQGSIMTVGEKVFSSNGQSITFDAIQEACARAGGRIAVPRNPEENEAIASFVKKYNTYAYVGLTEGPSPGDFRYSDGTPVNYTNWYRGEPAGRGKEQCVEMYTDGQWNDRNCLYSRLTICEF

Product Description

  • Expression Systems
  • in vitro E.coli expression system
  • Tag
  • 10xHis and B2M tag at the N-terminus, Myc tag at the C-terminus
  • Protein Format
  • Soluble
  • Purity
  • >90% as determined by SDS-PAGE.
  • Buffer
  • Tris/PBS-based buffer, 6% Trehalose, pH 8.0

Target

  • Target Protein
  • SFTPA2
  • Full Name
  • Surfactant protein A2
  • Introduction
  • This gene is one of several genes encoding pulmonary-surfactant associated proteins (SFTPA) located on chromosome 10. Mutations in this gene and a highly similar gene located nearby, which affect the highly conserved carbohydrate recognition domain, are associated with idiopathic pulmonary fibrosis. The current version of the assembly displays only a single centromeric SFTPA gene pair rather than the two gene pairs shown in the previous assembly which were thought to have resulted from a duplication.
  • Alternative Names
  • SFTPA2; PSAP; PSPA; SP-A; SPA2; PSP-A; SFTP1; SP-2A; SPAII; COLEC5; SFTPA2B; pulmonary surfactant-associated protein A2; 35 kDa pulmonary surfactant-associated protein; alveolar proteinosis protein; collectin 5; surfactant, pulmonary-associated protein A2A; Surfactant protein A2

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2024 Creative Biolabs. | Contact Us