Close
Close

Magic™ Membrane Protein Human SLC8A1 (Solute carrier family 8 member A1) for Antibody Discovery (CAT#: MP1405J)

Datasheet
This product is a 27.4 kDa Human SLC8A1 membrane protein expressed in Yeast. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • SLC8A1
  • Protein Length
  • Partial (396-627aa)
  • Protein Class
  • Ion Channel
  • Molecular Weight
  • 27.4 kDa
  • Sequence
  • VNTEVTENDPVSKIFFEQGTYQCLENCGTVALTIIRRGGDLTNTVFVDFRTEDGTANAGSDYEFTEGTVVFKPGDTQKEIRVGIIDDDIFEEDENFLVHLSNVKVSSEASEDGILEANHVSTLACLGSPSTATVTIFDDDHAGIFTFEEPVTHVSESIGIMEVKVLRTSGARGNVIVPYKTIEGTARGGGEDFEDTCGELEFQNDEIVKTISVKVIDDEEYEKNKTFFLEIG

Product Description

  • Expression Systems
  • Yeast
  • Tag
  • N-6xHis
  • Reconstitution
  • Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration).
  • Purity
  • >90% as determined by SDS-PAGE
  • Buffer
  • Liquid: Tris/PBS-based buffer, 5%-50% glycerol
    Lyophilized powder: Tris/PBS-based buffer, 6% Trehalose, pH 8.0

Target

  • Target Protein
  • SLC8A1
  • Full Name
  • Solute carrier family 8 member A1
  • Introduction
  • In cardiac myocytes, Ca(2+) concentrations alternate between high levels during contraction and low levels during relaxation. The increase in Ca(2+) concentration during contraction is primarily due to release of Ca(2+) from intracellular stores. However, some Ca(2+) also enters the cell through the sarcolemma (plasma membrane). During relaxation, Ca(2+) is sequestered within the intracellular stores. To prevent overloading of intracellular stores, the Ca(2+) that entered across the sarcolemma must be extruded from the cell. The Na(+)-Ca(2+) exchanger is the primary mechanism by which the Ca(2+) is extruded from the cell during relaxation. In the heart, the exchanger may play a key role in digitalis action. The exchanger is the dominant mechanism in returning the cardiac myocyte to its resting state following excitation.
  • Alternative Names
  • CNC; DKFZp779F0871; MGC119581; Na(+)/Ca(2+)-exchange protein 1; Na+/Ca2+ exchange protein 1; Na+/Ca2+ exchanger; NAC1_HUMAN; NCX 1; NCX; NCX1; SLC8A1; SLC8A1 protein; Sodium Calcium Exchanger; Sodium/calcium exchanger 1; Solute carrier family 8 (sodium/calcium exchanger) member 1; Solute carrier family 8 member 1

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2024 Creative Biolabs. | Contact Us