Close
Close

Magic™ Membrane Protein Human TGFBR2 (Transforming growth factor beta receptor 2) Expressed in NS0 for Antibody Discovery, Partial (23-159aa) (CAT#: MPX0188K)

Datasheet
This product is a 41.7 kDa Human TGFBR2 membrane protein expressed in NS0. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • TGFBR2
  • Protein Length
  • Partial (23-159aa)
  • Protein Class
  • Transferase
  • Molecular Weight
  • 41.7 kDa
  • TMD
  • 1
  • Sequence
  • TIPPHVQKSVNNDMIVTDNNGAVKFPQL
    CKFCDVRFSTCDNQKSCMSNCSITSICEKPQEVCVAVWRKNDENITLETV
    CHDPKLPYHDFILEDAASPKCIMKEKKKPGETFFMCSCSSDECNDNIIFS
    EEYNTSNPD

Product Description

  • Expression Systems
  • NS0
  • Tag
  • hIgG1 Fc tag at the C-terminus
  • Protein Format
  • Soluble
  • Reconstitution
  • Reconstitute with PBS to prepare a stock solution of 100 μg/mL.
  • Endotoxin
  • <0.10 EU per 1 μg of the protein by the LAL method.
  • Purity
  • >97%, by SDS-PAGE under reducing conditions and visualized by silver stain
  • Buffer
  • Lyophilized from a 0.2 μm filtered solution in PBS.

Target

  • Target Protein
  • TGFBR2
  • Full Name
  • Transforming growth factor beta receptor 2
  • Introduction
  • The protein encoded by this gene is a transmembrane protein that has a protein kinase domain, forms a heterodimeric complex with TGF-beta receptor type-1, and binds TGF-beta. This receptor/ligand complex phosphorylates proteins, which then enter the nucleus and regulate the transcription of genes related to cell proliferation, cell cycle arrest, wound healing, immunosuppression, and tumorigenesis. Mutations in this gene have been associated with Marfan Syndrome, Loeys-Deitz Aortic Aneurysm Syndrome, and the development of various types of tumors. Alternatively spliced transcript variants encoding different isoforms have been characterized.
  • Alternative Names
  • TGFBR2; AAT3; FAA3; LDS2; MFS2; RIIC; LDS1B; LDS2B; TAAD2; TBRII; TBR-ii; TGFR-2; TGFbeta-RII; TGF-beta receptor type-2; TGF-beta receptor type IIB; TGF-beta type II receptor; tbetaR-II; transforming growth factor beta receptor II; transforming growth factor beta receptor type IIC; transforming growth factor, beta receptor II (70/80kDa); transforming growth factor, beta receptor II alpha; transforming growth factor, beta receptor II beta; transforming growth factor, beta receptor II delta; transforming growth factor, beta receptor II epsilon; transforming growth factor, beta receptor II gamma; Transforming growth factor beta receptor 2

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2024 Creative Biolabs. | Contact Us