Close

Magic™ Membrane Protein Human TM4SF1 (Transmembrane 4 L six family member 1) Expressed in Yeast with 6xHis tag at the N-terminus for Antibody Discovery, Partial (115-161aa) (CAT#: MPX4636K)

This product is a 7.3kDa Human TM4SF1 membrane protein expressed in Yeast. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • TM4SF1
  • Protein Length
  • Partial (115-161aa)
  • Protein Class
  • Transporter
  • Molecular Weight
  • 7.3kDa
  • TMD
  • 4
  • Sequence
  • LAEGPLCLDSLGQWNYTFASTEGQYLLDTSTWSECTEPKHIVEWNVS

Product Description

  • Expression Systems
  • Yeast
  • Tag
  • 6xHis tag at the N-terminus
  • Protein Format
  • Soluble
  • Purity
  • >90% as determined by SDS-PAGE
  • Buffer
  • Tris-based buffer, 50% glycerol

Target

  • Target Protein
  • TM4SF1
  • Full Name
  • Transmembrane 4 L six family member 1
  • Introduction
  • The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. This encoded protein is a cell surface antigen and is highly expressed in different carcinomas.
  • Alternative Names
  • TM4SF1; L6; H-L6; M3S1; TAAL6; transmembrane 4 L6 family member 1; membrane component, chromosome 3, surface marker 1; transmembrane 4 superfamily member 1; tumor-associated antigen L6; Transmembrane 4 L six family member 1

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2024 Creative Biolabs. | Contact Us